KEGG   Eutrema salsugineum: EUTSA_v10013317mgHelp
Entry
EUTSA_v10013317mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eus  Eutrema salsugineum
Pathway
eus00250  Alanine, aspartate and glutamate metabolism
eus00410  beta-Alanine metabolism
eus00430  Taurine and hypotaurine metabolism
eus00650  Butanoate metabolism
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EUTSA_v10013317mg
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EUTSA_v10013317mg
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EUTSA_v10013317mg
   00430 Taurine and hypotaurine metabolism
    EUTSA_v10013317mg
Enzymes [BR:eus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EUTSA_v10013317mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18019216
NCBI-ProteinID: XP_006400267
UniProt: V4KUT7
LinkDB All DBs
Position
Unknown
AA seq 502 aa AA seqDB search
MVLSHAASDSDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGETETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVQKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEK
TERFNIVSKDVGVPLVAFSLKDNSSHTEFEVSDMLRRYGWIVPAYTMPPNAQHITVLRVV
IREDFSRTLAERLVIDIVKVMHELDELPSRMIHKISLGEEKSEANGDNLMVTVKKSDMEK
QREIINGWKKFVSDRKKTSGIC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctctcacgccgcatcggattccgatgtctccgtccactccacattcgcatca
cgatacgtccgaacttcacttccaaggttcaagatgccggaaaactcgattccgaaagaa
gcggcgtatcagataataaacgacgagttgatgcttgatggcaacccaaggctaaacttg
gcctccttcgtgacgacttggatggagcctgagtgtgataaactcatcatggcctccatt
aacaagaactatgtcgatatggacgagtaccccgttaccaccgaactccagaaccgatgt
gtgaacatgattgcacatctgttcaatgcaccgttaggagagacggagacggccgtcgga
gtagggactgttggatcatcggaggccataatgttggccggtttggccttcaagcggaag
tggcagaacaagcgtaaagccgaaggcaaacccttcgataaaccaaacattgtcaccgga
gccaatgttcaagtgtgttgggagaaattcgctaggtactttgaggttgagctaaaggaa
gtgaaactaagtgaaggatattatgtgatggacccggaaaaagctgttgagatggtcgat
gagaacactatctgtgttgcggccattcttggttccactcttaatggagaattcgaagat
gtaaaactcttgaacgatctcttggtccaaaagaacaaagaaaccggatgggatacaccg
atccatgtggatgcggcaagtggaggattcatagcaccgtttttgtatccggaattggaa
tgggactttagattgcctttggtgaagagtataaatgtgagtggtcacaagtatggactt
gtgtacgcaggaatcggttgggttgtttggagaaacaaagaggatttgcctgatgaactc
atcttccatatcaattatcttggtgctgatcaacccacttttactctcaatttctccaaa
ggttcgagtcaagtcatagctcaatactaccaacttatccgattgggccacgagggttat
agaaatgtgatggagaattgcagagagaatatgatcgtgctaagggaaggacttgagaag
acagaaaggttcaacatcgtctcaaaggacgttggagtgccacttgtcgctttctccttg
aaagataacagctctcacactgagttcgaagtatccgacatgcttcgcaggtatggatgg
atagtgccggcatatacaatgcctccaaacgcacaacacataactgttcttcgagtggtc
atcagagaagatttctcaagaacactcgctgagagacttgtgatcgatattgtgaaggtg
atgcatgagctcgatgagcttccttcgcgaatgatccacaaaatctcactaggagaggag
aaaagtgaagctaacggcgataacttgatggtgacggtgaagaaaagcgacatggagaag
cagagagagatcatcaatggctggaagaagtttgtctccgacaggaagaaaacgagcggt
atctgttaa

DBGET integrated database retrieval system