KEGG   Eutrema salsugineum: EUTSA_v10017094mgHelp
Entry
EUTSA_v10017094mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eus  Eutrema salsugineum
Pathway
eus04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:eus00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    EUTSA_v10017094mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EUTSA_v10017094mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 18027431
NCBI-ProteinID: XP_006409840
UniProt: V4MFH2
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
MMKTRKKKPNNMQCPNSSFVCPLASSKRQKANYTKAAMAAHTILSFSSTSRLLISPSSNP
TSPLLSSSSSSSTLRSSFRGVSLNLHRPQSVVSLSARAPSKKALTVVSAAKKAVAVLKGT
SDVEGVVTLTQDEDTGPTTVNVRITGLAPGPHGFHLHEFGDTTNGCISTGPHFNPNNMTH
GAPEDEIRHAGDLGNIIANADGVAETTIVDNQIPLTGPNSVVGRAFVVHELKDDLGKGGH
ELSLTTGNAGGRLACGVVGLTPL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagacacgaaaaaagaaaccaaataacatgcaatgtcccaattcatcgttcgtt
tgcccattagcttcctccaaacgtcaaaaagcaaattacacaaaagcagcaatggctgct
cacaccatcctctccttctcatcgacttctcgcctcctcatttctccttcatccaatcca
acttccccactcctctcttcttcttcttcttcctccactctccgttcctctttccgcgga
gtctctctcaacctccaccgtccccaatccgttgtttccttatccgccagagctccgtcg
aagaaagcgttgacggttgtttccgccgcgaagaaagctgttgcggtgctcaaaggaacc
tccgatgtcgaaggagttgttactttgacacaagacgaagacacaggtcctacaactgtg
aatgttcgtatcaccgggctagctccagggcctcatggatttcacctccatgagtttggt
gatacaacaaatggttgcatctcaacaggaccacatttcaaccctaacaacatgacacac
ggagctcctgaagacgagatccgtcatgcgggtgacctgggaaacataattgccaacgct
gatggcgtggcagaaacaacaattgtggacaatcagattcctctgactggtcctaactct
gttgttggaagagcctttgtggttcacgagcttaaggatgacctcggaaagggtgggcat
gagcttagtctgaccacaggaaacgcaggcgggagattggcttgcggtgtggttggtttg
acgccgctctaa

DBGET integrated database retrieval system