KEGG   Eutrema salsugineum: EUTSA_v10017998mgHelp
Entry
EUTSA_v10017998mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
Organism
eus  Eutrema salsugineum
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW DUF3672
Motif
Other DBs
NCBI-GeneID: 18009302
NCBI-ProteinID: XP_006390102
UniProt: V4KJD1
LinkDB All DBs
Position
Unknown
AA seq 1817 aa AA seqDB search
MDCKENGVSGPSGCGSSSGDKNVNSPGSSLAMDFDKNFSEKANSAGHDINLISSLATPQA
ALVLDPTIEGQRECFIEAEQMGDGNSISKEDAEKSDAGLPVSCIDNGCQKQGMVSDEFEQ
TQGSVPDAVLLVNCNKQDAGKESQDTELSSVLIVSGSMQEKGVPLTKEDEGSAGTILLPI
GVSETDTESTFVNYAPEQFESLETAKNINNDEVGSAGINPTFDCGGKEGRKEPSSDQDAG
SSDDISFIQSCPIPDSVLDSGILSCSATENYMKSPSEIEGNMPLVLSPSLDFTEMLSNND
GGLGSYDLDDITDTETINPDLKLVHEDDLHTDLSEKNENLLRNHVGDSSSEPAVAAPSMN
NNMAADLRTENFHKISPIDEKSLGMEANSPITDSSLICGSPLKFGNGALEARNSENAVEP
LRIVDDNGRIGGEVASASGTGESSSRRRTRDGKQGNMSQTRRSVPRQRKSPKKKQSERKL
ELIFKCSKQKRSSVSKPGRSSQWGLPSRTAEIFLQSTYIPSDGPPHHAPQQSQSNPKSGE
HNSSHNGYVEGSNRNSQASSGPCLRLKVKFGKSGGQNPLNITVSKVSGNSLPANGIVKTG
TGLEFPGPANDVEDKLRTVETIEHLEEKSNPVEELSMSSDSIRDEKNIQDAGGICRKLGG
DILDEDPHLSSSILVEECERATGTRSLDAETSPDSEVINSVPDSIVSIGLKGDLHHGFFS
TPEDVANKNRGLEKEDELLASRSPVENGSHLIPSAKKGKHPKSKGNGTKKGKSKFSESAK
DRRKNKSHEGLEQRKFIKRSIGRGDSYYHEVGRIESHETTGSLRDVDIGQTCAINGTKSS
DVIHGEAVLDVAIEDSSSTESAWVRCDDCFKWRRIPASVVESIDESSRWICGNNSDKDFA
HCSISQEMSNEDINEELGIGQDEADAYDCEAAKRGKDKEQKSKRSSGNRKACFKAIKTNQ
FLHRNRKSQTIDEIMVCHCKPPPDGRLGCGEECLNRMLNIECLHGTCPAGDLCSNQQFQK
RKYVKFERFQSGKKGYGLRLLEDVREGQFLIEYVGEVLDMQSYETRQKDYASMGQKHFYF
MTLNGNEVIDAGAKGNLGRFINHSCEPNCRTEKWMVNGEICVGIFSMQDLKKGQELTFDY
NYVRVFGAAAKKCYCGSSHCRGYIGGDPLNGDVIVQSDSDEEYPELVILDDDESGEGIVD
VTSRIFIDGADVQLPQNSTKVNDFKELASDNSQSQSSVYVKLPEREVLPSLQLTEVSKET
STDMPVIAVRQEVHVEKKTKSTSLTSSSLSRLPSDGANADKTVKDGSGEDKKILPRPRPR
MKTSRSSGSSKRDKGGLPTGVSKAQSIPVSKLQQQPVKSKASEEVSPSGRIETFEGKLNE
LLDAVGGISKRRDSAKGYLKLLLLTAASRGNANNEGIQSNRDLSMILDALLKTKSRTVLV
DVINKNGLQMLHNIMKQYRRDFKKTPILRKLLKVLEYLATREILALEHIIRRPPCAGMES
FKDSILTLTEHDDKQVHQIARNFRDRWIPKPFRKPWRIDREERSESIRSPINSRFRASQE
PRYDHHSPRPAEPYASVISSRAATPETTPVSEASSEPNSSNPETNGRKRKSRWDQPSMSK
EHRTMTVSSQQTDVTNGNQDVQDDLPPGFSSPCMDAPDAVTAQPQQKFLSRLPVSYGIPL
SIVHQFGSPGKEDPTSWSVAPGMPFYPFPPLPPVSHGEFFAKRNGAVCSSSMGNPTCSNE
ILPATTVPNQSSWNIPSVAGTDSTAPNRKREFSSDIGTSYFRQQKQNVPPWMRNNGWEKT
VNSPIPGNLTLERKLNN
NT seq 5454 nt NT seq  +upstreamnt  +downstreamnt
atggattgcaaggaaaacggtgttagtggcccttctgggtgtggctcctcttccggcgat
aagaatgttaactctccgggctcaagtcttgccatggatttcgataaaaacttctctgag
aaagcgaattctgctggccatgatataaatttaatcagtagtttggcgactccccaggct
gcattagttttagaccctacgatcgagggccagagggagtgctttatagaggctgagcaa
atgggagacggaaacagtatcagtaaagaagatgctgaaaaatctgatgccggtttacct
gtttcttgcattgataatggctgtcagaagcagggaatggtttcagatgaatttgagcaa
actcaaggatcagttcctgatgctgttttactagtaaattgcaacaagcaggatgctggg
aaagagagccaggacacagaattatccagcgtacttattgtttctgggagcatgcaagag
aaaggagttcctttgactaaagaagatgaagggtctgctggcacaatattattgcctata
ggggtcagtgaaacagatactgaatcgacttttgtaaattatgcacctgaacagtttgag
tctttggaaacggcaaagaacataaacaatgatgaagttggaagtgctggtattaacccc
acctttgattgtggaggtaaggaaggaagaaaagaaccatcgagtgatcaagatgctggt
tcttctgatgatatatctttcattcagagttgtccgattccagattctgtattggattct
ggaattcttagctgcagcgccacagagaattatatgaagtctccaagcgaaattgaaggc
aatatgcccctcgtgttatccccttcattagatttcacagaaatgttaagcaataatgac
ggtggcctaggttcatatgatcttgacgacatcacagacacagagacgatcaatccagat
ttgaagttggtacatgaggatgaccttcatactgatctttctgagaagaatgaaaatctg
ctaaggaatcatgttggggattcatcaagtgaacctgcagtggccgctccgagcatgaat
aataatatggctgctgatctgagaactgaaaatttccataagatatcacccatagatgaa
aagagcttaggtatggaagccaactcccctattactgactcttctttgatatgtggttct
cctttgaaatttggtaatggagctcttgaagctcgtaattctgaaaacgcagttgagcca
ctcagaatagttgatgacaatggcagaataggcggtgaagttgcttctgcatctgggact
ggtgagtcttcatcacgaaggaggacccgagatggtaaacagggtaatatgtcacagacc
agaaggagtgttcctcgtcagagaaaatcaccgaaaaagaaacaatcagaaagaaaactg
gaattaattttcaagtgctcaaagcagaagaggagctctgtttcaaaaccaggccgttca
tctcagtggggattaccaagtaggaccgctgaaatcttcttacagagcacttatattcct
tctgatggacctccacatcacgcaccacagcaatctcagagcaatcctaaaagtggagag
cataatagttctcataacggatatgtagaaggatctaacaggaatagccaagcatccagt
ggcccttgccttcgtttgaaagttaagtttggtaaatcaggtggccaaaatcctctgaac
attacagtctctaaggtcagtggcaactctttgcctgctaatggtattgttaagacggga
acaggtttagagtttccagggccagcaaatgatgtcgaggataaactccgaactgtagaa
actatagagcatttagaagagaaaagcaatcctgttgaggaactttcgatgtcatctgat
tctattagggatgaaaaaaatatccaagacgctggggggatatgtaggaagctgggtggt
gatattttagatgaggacccacacctttcctcgagtatattggttgaagagtgcgaaagg
gccactggaacccgatccctggacgctgaaacttcaccagattcagaagttattaactct
gtacctgattccattgtcagtattgggcttaaaggggatttgcatcatggttttttcagc
actccagaagatgtggccaacaagaatagaggattagaaaaagaagatgaattgcttgct
tcaaggtctcctgtggaaaatggttcacatctaattcccagcgcaaaaaaaggtaaacat
cctaagtcaaaaggtaatggaacaaaaaaagggaaatccaagttttccgaatctgccaaa
gacaggagaaaaaataaatctcacgaggggttagagcaacgcaaatttataaagaggagt
attggaaggggtgatagttattatcatgaagtagggagaatagagtctcacgaaacgaca
ggttctcttcgagacgttgatattggacaaacctgtgctattaatggtaccaaatcatca
gatgtgatccatggggaagcggtcctggatgttgctattgaggatagctcttccacagag
agtgcctgggttcgatgtgatgattgcttcaaatggcgacgaatacctgcttctgttgta
gagtcaattgacgagagctcgagatggatctgtgggaacaactcagataaagatttcgct
cattgctcaatatctcaagagatgtcaaatgaagacattaatgaagagttgggtatagga
caagatgaagcagatgcatatgactgtgaggcggctaaaagagggaaagacaaggaacaa
aagagcaaacgttcgtcaggtaaccgaaaggcgtgcttcaaagctataaaaacaaaccag
tttcttcatcgtaaccgtaaatctcaaacaattgacgagataatggtttgtcactgtaaa
ccaccacctgatggtaggctgggttgtggagaagaatgtctcaatagaatgcttaacatt
gaatgtcttcacggtacctgcccggctggcgatttgtgctcaaatcagcagtttcaaaaa
cggaagtatgttaaatttgagagattccaatctggtaagaagggttatggcctgagattg
ctcgaggatgtacgcgagggacaattccttattgaatatgttggagaggtgcttgatatg
caatcctatgagactcgtcagaaggattatgcttccatgggtcagaaacatttctatttc
atgacactgaatgggaatgaggtcatagatgctggtgcaaagggaaatttagggcgtttc
attaaccatagttgtgaaccaaactgtcgtactgaaaagtggatggtgaatggtgaaatt
tgcgttggaatattctccatgcaagaccttaagaagggtcaagagttgacatttgactac
aactatgtgagggtttttggtgctgctgcaaaaaagtgctattgtggatcatcacattgc
cgaggttatattgggggagatcctttgaacggtgatgtgattgttcaaagtgattcagat
gaagagtatcctgaacttgtgatcctagatgatgatgaaagtggggaaggaatcgtagat
gttacatctaggatcttcattgatggtgctgacgtgcaactgccacagaactctacaaag
gttaatgatttcaaggagcttgcttctgataattcccaatcgcagagctcagtgtatgta
aaacttccagagagagaggttcttccatctcttcaattaactgaagtttcgaaggaaact
tcgacggacatgcctgttattgctgtccggcaggaggttcatgtcgaaaagaagactaaa
agcacatctcttacgtcgagttctctcagcagactgccctcagatggtgcaaatgctgat
aagacagtaaaggatggctcgggtgaagataaaaagatacttccacgaccccgtcctcga
atgaaaacttctcgttcatctgggtctagtaagcgggacaaaggaggtcttcctactggt
gttagtaaagcacagagtataccggtcagtaagttgcagcaacagcccgtcaaatctaaa
gcatcagaggaagtttctcccagcgggcgtattgaaacatttgaagggaaactgaatgag
ttactcgatgctgtgggagggataagcaagcggagggattcagccaagggctacttgaaa
cttctgcttctcactgctgcttcccgaggcaatgccaataatgaaggaattcaaagcaat
cgagatctttcaatgattcttgatgcccttttaaagacaaagtcacgaacggttttagtg
gacgtaatcaacaagaatggtctgcaaatgttacataatatcatgaaacaatatcggagg
gattttaaaaagaccccaattctccgaaaacttttgaaggtattagagtatcttgctaca
agggaaattcttgcactagagcatataatcagaagacctccttgtgcagggatggaaagc
tttaaggactccattctaacactcaccgagcatgatgacaaacaggttcatcaaattgca
cggaacttccgagacagatggatccctaagccttttaggaaaccgtggcgcatcgacagg
gaggagagatcggaatctataagatcgcctatcaacagcagattcagagcatctcaagaa
cctagatatgatcatcattcgccaagacctgcagaaccatatgcgtctgtcatatcatca
agggctgcaactcctgaaacaactcctgtatctgaggcaagttcagaacctaattccagt
aatcccgagacaaatggacgcaagcgtaaaagcagatgggaccagccgtctatgtcaaag
gaacataggaccatgactgtctcatctcaacaaacagatgtgactaatggtaatcaggat
gtccaagacgaccttcctcccggattttcatcaccctgcatggatgcgcctgatgcagtt
actgcacagccgcaacaaaagttcctttctcggttaccagtttcctacgggatcccgctt
agcatcgttcatcaatttggttcacctggcaaagaggacccgactagctggtctgttgcc
cctgggatgcccttctatccattcccacctctaccgcctgtttctcatggtgagtttttc
gctaaaagaaacggagcagtctgttcctcatccatgggaaacccgacttgctctaatgag
atcttaccggctacaactgtgcccaaccagtcctcgtggaacatcccaagtgttgctggg
actgactcaaccgctccaaaccggaagagagagttttcgtctgatataggaacaagttac
tttcggcaacagaaacagaacgttcctccttggatgcggaacaacgggtgggaaaaaaca
gtaaacagccctatacctgggaatctaactttagagaggaagctcaacaattaa

DBGET integrated database retrieval system