KEGG   Eutrema salsugineum: EUTSA_v10018010mgHelp
Entry
EUTSA_v10018010mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
Organism
eus  Eutrema salsugineum
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 18008661
NCBI-ProteinID: XP_006391424
UniProt: V4JTQ8
LinkDB All DBs
Position
Unknown
AA seq 1410 aa AA seqDB search
MTSDSAGATTAVNISGNSETLNLNSTELYSSAISSVSPPLPPQKPPFSSPSIPQSKRIPK
TNFIVDLFRFPPSSDSSSSVAFFLSHFHSDHYSGLSPSWSRGIIFCSHKTSRLVKEILQV
PSQFVFPLPMNQKVVIDGSEVVLIDANHCPGAVQFLYKIKSVNDGFERYVHTGDFRFCDS
MRSDSYLSDFVGCDGVFLDTTYCNPKFVFPTQEESVDYVISAIDKIVEESKVMEKRVLFL
VATYVVGKEKILIEIAKRCKKKIFVDARKMSILSILECGESGMFTEDENESDVHVVGWNV
LGETWPYFRPNFVKMNEIMVEKGYDKVVGFVPTGWTYEVKRNKFAVKSKDSMEIHLVPYS
EHSNYDELREYIKFLKPKKVIPTVGVDIEKLDSREVYKMQKHFSGLVDEMANKKDFLLGF
YQKKKKNDIDVVSSLTEVYQGEDKKACEDSETPCEIIDAFPSSTGSLVHNTAPRSNDSLV
TERLLTELRDCLPGWVTEEQMLDLINKHDGNPVDIVSNFYEREAELYKQSSLATSSSENQ
AVLVDDSVTGLQLNPVKSTWSDCQPSQKGFALPSKVGLTKGTISPGKRSKSIGNKSNKKV
KKDPKSKPVGPRQSTITKFFDKALDSGSNSVGVGSETEECITDEKMVHNDATEAYKELTD
QFIDIVNGSESLREYAASIIDEAKGDINRALNIYYSNPSGIPGEHAGEGVLSSKSNQFPQ
CPEACSSQEDKKALEKSGNAVNLCGQISAEEIADKSYVSLPPEKYKPKEHACWRDGQPAP
YIHLVRTFASVEAEKGKIKAMSMLCNMFRSLMALSPEDVLPAVYLCTNKIAADHENIELN
IGGSMISSALEEACGISRATIREMYNRLGDLGDVAQLCRQTQKLLVPPPPLLVRDVFSTL
RKISVQTGTGSNRQKKNLIVKLMRSCREKEIKFLVRTLARNLRIGAMLRTVLPALGRAIV
MNSFWNCHNKEPSEKCFREKLEVVSAAVVEAYNILPSLDVVVPSLMDKDIEFSTSTLSMV
PGIPIKPMLAKIANGVQDFFKLFQDKAFTCEYKYDGQRAQIHQLLDGTVRIFSRNGDETT
SRFPDLVDVIKQFSCHAAETFMLDAEVVAIDRKNGNKLMSFQELSTRERGSKDDLVTRER
IKVEVCVFVFDIMFLNGEQLLAFPLRERRRRLKEVFPETRPGYLEYAKEIIVGADEASLN
NQDTLCRINAFLEEAFQSSSEGIMVKSLDVDAGYYPTKRSDSWLKVKRDYVDGLGDTLDL
VPIGAWHGNGRKAGWYSPFLMACFNPETEEFQSVCRVMSGFSDAFYIEMKEFYSGDKILA
KKPPYYRTGETPDMWFSAEAVWEIRGADLTVSPVHHAGLGLVHPSRGISVRFPRFIRKVN
DRNPEECSTAAEIAEMFQAQTRKMNITSQH
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcagactccgccggagccacaaccgccgtcaacattagcggtaactcagaaacc
ctaaatctcaattccacagaactctactcatcagcaatttcctctgtttctccaccgctc
cctccacagaaaccaccgttctcttctccttcaatccctcaatcaaaacgtatccccaaa
actaacttcatcgtcgatttgtttcgcttcccaccatcttccgattcctcctcctccgtc
gctttcttcctctcacacttccactccgatcattactccggcctctctccgtcttggtcc
agaggaatcatcttctgctctcacaaaacctctcgcctcgtgaaagaaatccttcaagtt
ccatcacagttcgtcttccctttgcctatgaatcaaaaggttgtgatcgatggctctgag
gttgttctgattgatgcaaatcactgcccaggagcggtacagttcctgtataaaatcaaa
tcggtgaacgatggtttcgagaggtacgttcacaccggagatttcagattctgtgattcg
atgagatcagattcgtatcttagtgatttcgttggctgtgatggtgtttttcttgacact
acttattgcaatccaaagttcgttttccccactcaagaagagtctgttgattatgtgatt
agtgctatagataagattgttgaagagtctaaggttatggagaaaagggttttgtttctt
gttgccacttatgttgttggtaaagagaagattctgattgagattgctaagagatgcaaa
aagaagatctttgtggatgcgaggaagatgtcgattttgtctatcttggagtgtggagag
agtggaatgtttacagaagatgaaaacgagagcgatgttcacgttgtgggatggaatgta
ttgggtgagacttggccgtatttccggccgaatttcgtgaagatgaatgagattatggtt
gagaaagggtatgataaggttgtaggttttgtgcctacagggtggacttatgaagtgaag
cggaataagtttgcggtgaagtctaaagattcgatggagatccatcttgtaccgtatagt
gagcattcgaactacgatgaactgagagagtacataaagttcttgaaacctaagaaagtt
attcccactgttggagttgatatcgagaagcttgatagcagagaggtttacaaaatgcag
aagcacttttctggactggtggatgaaatggctaacaagaaggatttcttattgggtttc
tatcaaaagaaaaagaaaaatgacatagatgtggtgtcaagcttgactgaggtttaccaa
ggagaagataagaaggcatgtgaagacagtgaaactccatgcgagataatagatgcgttt
ccgtcatctacaggatccttagtgcataatacagctccaagaagtaatgattctttggtg
actgaaagattgctgacagaattacgtgattgtttgcctggttgggtcactgaagagcag
atgttagatctgattaataaacatgatggtaatcccgtagatatagtaagtaacttttat
gaacgtgaagcagagctttacaagcaatcctctcttgccacgtcttcctcggaaaatcag
gctgttttggttgatgatagtgtaaccggcttgcaactaaatcctgtaaagagcacttgg
tcagattgtcaaccaagtcaaaaaggttttgccttaccaagcaaagtcggtttaacaaag
ggtactatttctcctggaaaaagaagcaaaagcataggcaataagtcaaacaagaaggtc
aagaaagatccaaagtcgaaaccagttggtccaaggcagtcaacgataactaagttcttc
gataaggccttggatagtggatctaattctgttggtgttggttcagagactgaagaatgc
attacagatgaaaagatggtccacaatgatgctacagaagcatacaaagaattaacagat
cagtttattgatattgttaatggttctgaatctttaagagagtatgctgcttccatcatt
gatgaggctaaaggagatataaatagggcattgaacatttattacagtaaccccagtgga
atacctggtgagcatgcaggtgagggagtactctctagcaaatcaaatcagtttccgcaa
tgtccagaagcgtgttcctctcaggaggacaaaaaagcgctagaaaaatcaggaaatgcc
gttaacttatgtggacagatatcagcagaggaaattgcggacaaaagttatgtatctcta
ccacctgagaagtataaacctaaggagcacgcttgttggagggatgggcagcctgctcct
tatatccaccttgtccgaacgtttgcttcagttgaagctgaaaagggcaagatcaaagct
atgtctatgctttgcaacatgtttagaagtttgatggctctctctccagaagatgtcctg
cccgctgtttatctttgcacaaacaagattgccgctgaccatgaaaatattgagcttaat
attggtggaagtatgatctcttctgcattggaagaagcatgtggaataagtcgcgctact
ataagggagatgtataatagattgggggatcttggggatgttgctcagctatgtcgacaa
acacaaaagctactggttcctcctcctccacttctagtgagagatgtgttttcaactcta
cgaaagataagtgtgcagacaggtactggaagtaatcggcaaaagaaaaacctcatcgtg
aagctaatgcgctcttgtagagagaaagagatcaaatttcttgttagaacattggcccgt
aatttaaggattggcgctatgttgaggactgttctacctgcacttgggcgagcaatcgtt
atgaattctttctggaattgccataacaaagaaccatcagaaaaatgtttcagagagaaa
ctcgaggttgtttctgctgcagtagttgaggcatacaatatacttccttctctggacgtg
gtcgttccttctctcatggacaaagacattgagttctcaacatcaactctgtcaatggtc
ccagggatacctataaaacccatgcttgcaaaaatcgctaacggggttcaggattttttc
aaactcttccaagacaaggcttttacatgtgaatacaaatatgatggccagcgcgcccag
atccatcagttacttgatggtaccgtgcgtattttttctcgaaatggggatgaaacaact
tctagatttccagatctggttgatgttattaaacagttttcttgccatgctgctgagact
ttcatgttggacgcagaggtggttgcaattgatagaaagaatggaaataaactcatgtca
ttccaagagttatcaacaagagagagaggaagcaaagatgatttggtaactagagaacgc
attaaggttgaagtctgcgtatttgtgtttgatattatgttcctcaatggtgaacagctg
ttggcttttccccttcgtgagagacgaagacgtctaaaggaggtcttccctgagactagg
ccgggttatcttgagtatgcgaaggaaatcattgtaggagcagacgaagcgtctttgaat
aaccaagacactttgtgtagaataaatgcttttctagaagaagcatttcagtcatcttct
gaaggaatcatggttaagtccttagatgttgatgccggatactaccccacaaagcgttct
gattcatggctcaaggttaagcgagattatgtagatggattaggtgacacattggattta
gttcctataggtgcttggcatggcaacgggagaaaagcaggatggtatagtccattcctc
atggcctgctttaaccctgagacagaggagttccaaagtgtctgccgtgtcatgtctggc
ttttctgatgccttttacattgagatgaaagagttctactcaggggataagatcctagcg
aaaaagccgccttactacagaactggggagacaccggacatgtggttttctgcagaggct
gtatgggaaatcagaggtgcggatttaaccgtctcgccggttcaccatgccggtttaggt
ctcgttcatccatctcgaggcatctcagttaggtttcctagatttatccgtaaagtgaat
gataggaatccagaggaatgcagcacggctgcagaaatcgcagagatgtttcaagctcaa
accaggaaaatgaacatcacgtctcaacactaa

DBGET integrated database retrieval system