KEGG   Eutrema salsugineum: EUTSA_v10019997mgHelp
Entry
EUTSA_v10019997mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eus  Eutrema salsugineum
Pathway
eus00620  Pyruvate metabolism
eus00710  Carbon fixation in photosynthetic organisms
eus01100  Metabolic pathways
eus01200  Carbon metabolism
Module
eus_M00168  CAM (Crassulacean acid metabolism), dark
eus_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
eus_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
eus_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EUTSA_v10019997mg
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EUTSA_v10019997mg
Enzymes [BR:eus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EUTSA_v10019997mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 18023596
NCBI-ProteinID: XP_006407030
UniProt: V4M826
LinkDB All DBs
Position
Unknown
AA seq 968 aa AA seqDB search
MAGRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL
YELSAEYEGNREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK
KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYNQIENLMFELSMWRCTDEFRAKADELHRNSRKDAAKHYIEFWKT
IPPTEPYRVILGDVRDKLYHTRERSRQMLSNGISDIPEEATFTNVEQFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESERHTDVLDAITKHLDIGSSYRDWSE
EGRQEWLLAELSGKRPLFGPDLPKTEEIADVLDTFKVISELPSDCFGAYIISMATSPSDV
LAVELLQRECHVKKPLRVVPLFEKLADLEAAPAAVARLFSLDWYKNRINGKQEVMIGYSD
SGKDAGRLSAAWELYKAQEALVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDT
VNGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVSPKPEWRALLDEMAVV
ATEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQ
TRFHLPVWLGFGAAFRYAIKKDVRNLHMLQDMYKHWPFFRVTIDLIEMVFAKGDPGIAAL
YDKLLVSEDLWAFGEKLRTNFEETKNLVLQTAGHRDLLEGDPYLKQRLRLRDSYITTLNV
CQAYTLKRIRDPNYNVTLRPHISKEFMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGI
AAGLQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcggaacttagagaagatggcatcaattgatgcgcagcttcgtcaactggtt
cctgctaaagtcagtgaagacgataagcttgttgagtatgatgctcttctcctcgatcgc
tttctcgacattctccaggatctacacggcgaggatctccgtgaaaccgtccaagagctg
tacgagctttctgctgagtatgaagggaaccgtgagcctaagaagcttgaggaactaggg
agcgtcctaacgagtttggatccaggtgactccattgttatctccaaggctttctcccac
atgcttaacttagccaacttggccgaggaggtgcagattgcttaccgtcgcaggatcaag
aagctcaagaagggtgatttcgttgatgagagctctgctactactgaatccgatatcgaa
gagactttcaagagactcgtctcggatcttggtaagtctcctgaagagatctttgatgcc
ctgaagaatcagactgtggatcttgttttgactgctcatcctactcagtccgtgcgtaga
tctttgcttcagaagcatggcaggataagggactgtctagctcaactgtatgcaaaggat
attactcctgatgacaagcaggagcttgatgagtctcttcaaagagagattcaagctgca
tttcgcacagatgagattagaagaacacctccaacgccgcaagatgaaatgagagctgga
atgagctacttccacgagacaatctggaaaggtgtccctaagttcttgcgccgtgtggac
acagctctgaaaaacattgggattgatgagcgtgtcccttacaatgccccattgattcag
ttctcgtcttggatgggtggtgatcgtgatggtaacccgagggtcacacctgaggtcact
agagatgtgtgcttgctggctagaatgatggctgccaatctctactataaccaaatcgag
aatctgatgtttgagttgtctatgtggcgttgcactgatgagttccgtgccaaggctgat
gaactccacaggaactcaaggaaagatgctgcaaaacattacatagaattctggaagaca
attcctccaactgagccatatcgtgtgattcttggtgatgtgagggataaactgtatcac
acacgtgagcgctctcgccaaatgctgagcaacggaatctcggacatccctgaagaagct
actttcaccaatgtggaacagttcttggagcctcttgagctatgttaccgatcactatgt
tcatgtggtgaccgcccaatagctgatggaagccttcttgatttcctgagacaagtctct
acctttggactctcccttgtgagacttgacattaggcaagagtctgaacgccacaccgat
gtcttggatgctatcaccaagcacttggacatcggttcctcctatagagactggtctgaa
gaaggccgacaggaatggcttctagctgaactaagcggcaagcgtccacttttcggacct
gatcttcccaaaaccgaagaaattgctgatgtcctggacacattcaaagtcatatcagag
cttccttcagattgctttggagcttacattatctctatggcaacttcaccaagtgatgtg
cttgcagttgagcttttacagcgtgaatgccacgtgaaaaagccactaagagttgttcca
ctctttgagaagctagctgatcttgaagcggctcctgctgctgttgcaagactcttttct
ttagactggtacaaaaaccgtatcaacggtaaacaagaggttatgatcggttactcagat
tcagggaaagacgctgggcgtctctcagctgcttgggaactatacaaagctcaagaagcg
cttgtgaaggttgctaaggaatatggagtgaagctgactatgttccatggccgtggtggc
acagtcggaagaggaggtggtcccactcatcttgctatattgtctcagccaccggacaca
gttaatggctcactccgagtcacggttcagggtgaagtcatcgagcaatcgtttggagag
gaacacttatgctttaggacacttcagcgtttcacagctgctactcttgagcacggaatg
aaccctccggtttcaccaaaacccgagtggcgtgctttgctagatgaaatggcggttgtt
gcaactgaggaataccgatctgtcgttttccaagaacctcgatttgtcgagtacttccgc
ctcgctactccggagttggagtatggacgtatgaacatcggaagcagaccatcaaagcga
aaaccgagcggtgggatcgaatctctccgtgcaatcccatggatctttgcatggacacaa
acaagattccatcttcctgtatggttaggattcggagcagcgttcaggtatgcaatcaag
aaggatgtgaggaacctacacatgctgcaagatatgtacaaacactggccgtttttccga
gtcaccatcgatcttattgaaatggtgttcgccaagggagaccccgggatcgctgctttg
tatgacaaactccttgtctcagaggatttatgggctttcggagagaaactcagaaccaac
tttgaagaaaccaagaaccttgtcctccagactgctggacacagagaccttcttgaagga
gacccttacttgaaacagagacttaggctgcgtgactcttacattacaaccctcaatgtt
tgccaagcctacacattgaagagaatccgcgatccaaactacaatgtgactctgcgacca
cacatttccaaggagtttatgcaatcaagcaaatcagcacaagagctcgtcaagcttaac
ccaacgagtgaatacgcacctggacttgaggacacgctcatcttaacaatgaagggtatt
gccgcaggactgcaaaacaccggttaa

DBGET integrated database retrieval system