KEGG   Eutrema salsugineum: EUTSA_v10020293mgHelp
Entry
EUTSA_v10020293mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eus  Eutrema salsugineum
Pathway
eus00564  Glycerophospholipid metabolism
eus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EUTSA_v10020293mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EUTSA_v10020293mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 GIDA HI0933_like Pyr_redox 3HCDH_N Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 18023783
NCBI-ProteinID: XP_006407577
UniProt: V4LF02
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MSVASIRRLAVGAAVIAAASGGAVYLAPSVASSDRGGGPILDSLRRRIGDPTASVPSRSA
QESVLIGASSSNPLDVLVIGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVIYFWMG
LKMYDLVAGPRLLHLSRYYSAQESAELFPTLARKGKDKSLRGTVVYYDGQMNDSRLNVGL
ACTAALAGAAVLNHAEVVSLITDDATKRIIGARVRNNLTGQEFDSYAKVVVNAAGPFCDS
IRKMVDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTSITALPEPHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESISR
DHVVIEECPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLNPTNECVTQKLQLLGSYGWEP
SSFTALAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGKRLAH
GHPFLEAEVAYCARQEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDQSR
EKQELQKAKEFLQTFKSSKNAQFHDGKHN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcgcttctattcgccgtttagccgtcggagccgccgtaattgccgctgcatcc
ggtggcgctgtctaccttgccccgtcggttgcctccagcgacagaggcggtggtccgatt
ctagattcattgaggcgtaggattggtgatcccaccgcttccgtaccttctcgatctgct
caagagtctgttctgattggagccagctcttctaatcctctcgatgtcctcgtcattggc
ggtggagccaccggttctggtgtcgccctcgacgctgctacacgcggtctccgtgttggt
ctggtagagcgggaggatttctcctctgggacgtcttcgcgttcaactaagctaattcat
ggaggggttcgctacttggagaaagctgttttcaatcttgattatggacagctgaagctt
gtattccatgcgcttgaggagcgtaaacagctcattgagaatgcgccacatctctgccat
gctctgccctgtatgactccttgttttgactggttcgaagttatctacttctggatggga
ttgaagatgtatgacttggtcgcaggaccacgactattgcatctttccagatattactct
gcacaagagtctgctgagctcttccccactcttgcaaggaaagggaaagacaagagtttg
aggggcactgttgtgtattatgacgggcaaatgaatgattcacgtctgaatgtgggtttg
gcatgtactgccgctttagctggtgctgcagttctcaaccatgccgaggttgtatcgctt
atcacagacgatgctactaagagaataattggtgcccgggttcgtaacaatctcacaggc
caagaatttgatagctatgcaaaagtagttgtgaatgcggctggaccgttctgtgattcc
attaggaagatggttgatgaagatacaaaaccgatgatatgtccaagtagcggagtacac
atcgtgctccctgattactattctccagaagggatgggcttgatagtccctaaaactaag
gatggtcgcgttgtgtttatgttgccgtggttgggacgaacagtagcaggcactacagac
tctaacacgtcaatcactgcacttccagaacctcatgaagatgagattcagtttatactg
gacgcaatcagcgactatcttaacattaaggttcgacgtactgatgttctttcggcttgg
agtggtatccgtccactggcaatggatccaacagcaaagagcacagagagtatctccaga
gaccacgttgtcatcgaggaatgtcctggtctagttacaatcacaggtggaaaatggaca
acttaccgaagcatggcggaagatgcggttgatgcagcaatcaaatcgggaaagctgaat
ccaaccaatgaatgtgtaacacagaaactacagcttctgggttcttatggatgggaacca
tcttccttcacagctcttgcacagcaatacgtgcgcatgaaaaaaacctatggtggtaaa
gtggttccaggagcaatggacacagctgcagctaagcatttgtctcatgcctatggttca
atggctgaccgagtcgccaccatagctcaggaggagggtttggggaaacggctagcacac
gggcatccgtttctggaagcagaggttgcttactgtgcaaggcaagagtactgcgaatca
gcggttgatttcatagctaggagatgtagaatcgcgttcttggacacggacgcagcggca
cgggcgttgcagcgtgtggtggagattctagcaagtgaacacaagtgggaccagtcgagg
gagaagcaggagttgcaaaaggctaaagagtttcttcaaactttcaagtcttccaaaaac
gcacagtttcacgatggcaaacacaactga

DBGET integrated database retrieval system