KEGG   Eutrema salsugineum: EUTSA_v10020704mgHelp
Entry
EUTSA_v10020704mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
eus  Eutrema salsugineum
Pathway
eus03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EUTSA_v10020704mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eus03036]
    EUTSA_v10020704mg
   03400 DNA repair and recombination proteins [BR:eus03400]
    EUTSA_v10020704mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     EUTSA_v10020704mg
Chromosome and associated proteins [BR:eus03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    EUTSA_v10020704mg
DNA repair and recombination proteins [BR:eus03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EUTSA_v10020704mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD Exo70
Motif
Other DBs
NCBI-GeneID: 18024743
NCBI-ProteinID: XP_006407780
UniProt: V4M9Z5
LinkDB All DBs
Position
Unknown
AA seq 456 aa AA seqDB search
MVPPVIYKYRRRRYRRLGRDDDGSLMRTPRVSLYHSNDRFNSNTIEVSDNSRSSGSFSED
GARIRNLGCVHSETETRHGSCSLVLQCRNLDDLFAGFAYKGVRKTRNVFGSKPKSTLDDD
DTVKEQDFDDDSVFESHSERQVCSEFQTQVRKVSPYFQGSTVSQQPKDGCDSDCVSSQNG
RNYRKECRKVQAKVRRVSPYFQASTFSQCDSESVASQSGRKYRKESSKLQAKVPRVSPYF
QGSTVSEQPNPSRDLRQYFKVVKVSRYFHDMPADGTQVNEPQKERSRRMRKTPVVSPSLS
QCQKTDEAYLRKMPDNTWVPPRSPCNLLQEDHWHDPWRVLVICMLLNKTSGAQTRGVISD
LFVLCPDAKSATEVEEKEIESLIKPLGLQKKRAKMIQRFSLEYLQESWTHVTQLYGVGKY
AADAYAIFCNGKWDCVRPADHMLNYYWEFLRIRYRL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggttcctccagtaatttataagtatcggcgaaggagatatcggagacttggaagggac
gatgatggttcgttgatgaggactcctcgggtctcactttaccattcaaacgacagattc
aactccaataccatcgaagtaagtgataatagtcgctcttctggttcatttagcgaggat
ggtgctagaattcgaaatttgggttgcgttcacagtgagactgaaactagacatggttcc
tgtagtttggttcttcaatgtagaaacttggatgatttgttcgctgggttcgcttataaa
ggtgtgaggaagacaaggaatgtatttggaagtaaaccaaagagtactcttgatgatgat
gacaccgtaaaggaacaagattttgatgatgacagtgtttttgaatctcacagtgaaaga
caagtttgcagtgaatttcagactcaagtaagaaaagtttctccatacttccaaggatca
actgtttcacaacagcccaaagatgggtgtgattctgattgtgtttcttctcaaaatgga
agaaactataggaaagaatgtagaaaagttcaagctaaagtccgaagagtttctccatac
ttccaggcatcaaccttttcacaatgtgactctgaaagtgttgcttctcaaagtggaaga
aaatataggaaagaaagcagcaaacttcaagctaaggtcccaagagtttcaccatacttc
cagggatcaactgtttcagaacagccaaacccgtcaagagatttgcgtcagtattttaag
gtcgtgaaagtttcaagatatttccatgacatgcctgcggatggaacccaagttaatgaa
ccacaaaaggagagatcaagaaggatgaggaaaactcctgttgtgagcccttcgctctct
caatgtcagaagaccgatgaggcatacctgaggaaaatgccggataacacatgggtgcct
ccacgatctccttgtaacctgcttcaagaagatcattggcatgatccatggcgagtactg
gtcatttgtatgcttctcaacaaaacatctggtgcacagacgcggggagtgatatcagac
ttgtttgtgctgtgtcctgatgcaaagtctgcaacagaagttgaagaaaaggagattgag
tctctgataaaacctcttggattacagaagaagagagccaaaatgatacaacggttttct
ctggagtatcttcaagagagctggactcatgtcactcaactgtatggcgttggaaagtat
gcagcggatgcgtatgcgatattctgtaatggaaagtgggattgtgtgagacctgctgat
catatgctaaattattactgggaattcctcaggattcggtacaggttatga

DBGET integrated database retrieval system