KEGG   Eubacterium sulci: ADJ67_00965Help
Entry
ADJ67_00965       CDS       T04038                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
euu  Eubacterium sulci
Pathway
euu00473  D-Alanine metabolism
euu00550  Peptidoglycan biosynthesis
euu01100  Metabolic pathways
euu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:euu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ADJ67_00965
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ADJ67_00965
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ADJ67_00965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:euu01011]
    ADJ67_00965
Enzymes [BR:euu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ADJ67_00965
Peptidoglycan biosynthesis and degradation proteins [BR:euu01011]
 Precursor biosynthesis
  Amino acid ligase
   ADJ67_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A Etmic-2
Motif
Other DBs
NCBI-ProteinID: AKT46414
LinkDB All DBs
Position
211802..212884
Genome map
AA seq 360 aa AA seqDB search
MEDKLEKLLVIFGGLSPEHDVSCLSAASLTSNVDRSRFELKCLGITREGRWLLTEATSEE
IKSGEWKNREDNIAVFLSTDMSRKGLYRWDDASEPIYIPDCLLPILHGEYGEDGSIQGIF
KYAGIPYIGPGIMSSAVAIDKAITKRLVKGLDLMQADYLEFKLEDGDVKAQCEEIASYFS
NRYPIFVKPANAGSSIGVSKVSSASEIRDAVSEAYKHHNKIVVEEGISGREIEVAVLDCG
NGELIASRIGEIVSDDRFYSFDEKYKDSVKTKVGICDDLNDEIVCEIQEQAKAVFRVLEC
KGLSRVDFFYTDDGEICFNEINTMPGFTEHSMYPKLIMDKGISYSELITTLVDGAIKQFE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ctggaggacaaattggaaaagcttttagtaatattcggtgggctatcgccagagcacgat
gtctcctgcctttcggcagcatcccttacatcaaatgtggatagaagcagattcgagctt
aaatgtctcggcataacgagagaaggcagatggcttttgacggaagcgactagcgaagag
ataaaatcgggcgagtggaagaatagagaagataatatagctgtatttttgtcaacggat
atgtcgaggaagggtctttatcgctgggatgatgcgagcgagcctatctatatcccggat
tgcctattaccgatattacatggcgaatacggtgaagatggctcaattcagggcattttc
aagtatgcgggcattccgtatataggtccaggaattatgtcatcggcagttgcaattgac
aaagcgataaccaaaaggctggtcaaaggcttagaccttatgcaggctgattatctagag
tttaagctagaagatggtgatgtcaaagcgcagtgcgaggagatagcaagctacttcagt
aacagataccctatatttgtcaaaccagctaatgcaggttcatccataggtgtaagtaag
gtgagcagtgcttcagagattagagatgcagtttctgaggcatataagcaccataataaa
atagttgtcgaggagggcatatcgggtcgtgaaattgaggtagctgttttagactgcggg
aatggtgagctaattgcttcgaggataggtgagattgtcagcgatgataggttttactca
tttgatgagaagtacaaggattcggttaagaccaaggttggcatctgcgatgacctaaac
gatgaaatagtctgtgagattcaggagcaggccaaggcagtattcagggtccttgaatgc
aaggggctttctagggtggacttcttctatactgatgatggtgagatttgctttaacgag
ataaatacaatgccaggattcactgagcacagtatgtatcctaaacttataatggacaag
ggaattagctattcagagctgattactacgctcgtggatggtgcgattaaacaatttgaa
taa

DBGET integrated database retrieval system