KEGG   Euzebya sp. DY32-46: DVS28_a0474Help
Entry
DVS28_a0474       CDS       T05999                                 

Definition
(GenBank) Uracil-DNA glycosylase, family 5
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
euz  Euzebya sp. DY32-46
Pathway
euz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:euz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DVS28_a0474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:euz03400]
    DVS28_a0474
Enzymes [BR:euz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     DVS28_a0474
DNA repair and recombination proteins [BR:euz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DVS28_a0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Rpn9_C
Motif
Other DBs
NCBI-ProteinID: AXV05181
UniProt: A0A346XSI4
LinkDB All DBs
Position
complement(587235..587945)
Genome map
AA seq 236 aa AA seqDB search
MTPSPDPSAPKDAPPAHASLAEVGAAVAACRACPRLVEWREEVGRVKRRAFADEDYWARG
VPGFGDPTAKLLVLGLAPAAHGANRTGRMFTGDRSGDFLYAALHRAGLANQPEAVGLDDG
LVLNRVWITSPVKCAPPANKPTAAERDECAPYLADELRLLQPEVILCLGRFAWDGAWMFL
GKPRPKPAFGHGAVAEVEGLALVGSYHVSQQNTFTGRLTEDMFDEALGMAVELAYG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgtcgcctgacccatccgcgccgaaggacgccccgcccgcccacgcctcgctg
gccgaggtcggtgcggcggtcgccgcctgccgtgcctgcccgaggctggtggaatggcgg
gaggaggtcggacgcgtcaagcgccgggccttcgccgacgaggactactgggcgaggggg
gtgccgggcttcggcgatcccaccgccaagctgctggtcctcgggctggcccccgcggcc
cacggcgccaaccggacggggcggatgttcaccggcgaccgctcgggtgacttcctctac
gccgcgctgcatcgggcggggctggccaaccaacccgaggcggtgggactcgacgacggg
ctggtgctgaaccgggtgtggatcacctcaccggtgaagtgcgcacccccggccaacaaa
ccgaccgccgccgaacgagacgagtgcgcgccctacctggccgacgagctccggctgctg
cagcccgaggtcatcctctgcctcggccgcttcgcgtgggacggggcctggatgttcctc
ggcaagccgcgacccaagcccgccttcgggcacggggcggtggccgaggtcgaggggttg
gcgttggtcggcagctatcacgtcagccagcagaacaccttcacgggccggctgacggag
gacatgttcgacgaggccctgggcatggcggtcgagctggcgtacggctga

DBGET integrated database retrieval system