KEGG   Echinicola vietnamensis: Echvi_0773Help
Entry
Echvi_0773        CDS       T02388                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
evi  Echinicola vietnamensis
Pathway
evi00020  Citrate cycle (TCA cycle)
evi00310  Lysine degradation
evi00380  Tryptophan metabolism
evi01100  Metabolic pathways
evi01110  Biosynthesis of secondary metabolites
evi01120  Microbial metabolism in diverse environments
evi01130  Biosynthesis of antibiotics
evi01200  Carbon metabolism
Module
evi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
evi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Echvi_0773
  09105 Amino acid metabolism
   00310 Lysine degradation
    Echvi_0773
   00380 Tryptophan metabolism
    Echvi_0773
Enzymes [BR:evi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Echvi_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AGA77048
UniProt: L0FVL4
LinkDB All DBs
Position
complement(870397..873195)
Genome map
AA seq 932 aa AA seqDB search
MDKYSYISNAHVAYIDELYEDYKKDPESIEPSWKTFFDGFDFAITKFGEDEDGGAVSGGS
SNGAAKNGALATKGTIMDMEQLPKEIKVRALIHAYRSRAHLRSKTNPVRERRDRKALIDL
EDFGLSEADLNTEFQAGNEIGIGDAKLSKILESLRKIYEGTMGFEYLYIRDPEMLDWFRQ
KIEKEALAFNPPDEEKKRILYKLNEAVVFENFLHTKYLGQKRFSLEGGESTIPFLDAVIN
KSADLGAEEVMIGMAHRGRLNVLANVMGKTYEQIFSEFEGTAKPDLTMGDGDVKYHMGFS
SEITTPSDKKINLKLAPNPSHLEAVNPVVEGFVRAKIDHQYEGDKDKVVPILIHGDAAVA
GQGIVYEVTQMANLKGYNTGGTIHFVINNQVGFTTDFDDARSSIYCTDVAKIIDAPVIHV
NGDDPEAVVFAAKLAADFRQRYNQDIFIDMVCYRRHGHNESDEPKFTQPNLYNIISKHPN
PREIYNKELMERGDVDAKLAKQMDKEFRKLLQDRLNMVKEKPLPYKSSPFEQAWKELRKS
EPADFDKSPDTYISEEAIEKVAEALTSLPKGFKPIKQIEAQMKQRKDMFYSSKSLNWAAA
ELLAYGSLLLEGKTVRLTGQDCRRGTFSHRHAVLHDANTNKSYNSLKEMKDNKGQFHIYN
SLLSEYAVLGFEYGYAMANPNALTIWEAQFGDFANGAQTMIDQFISSGESKWQKMNGLVM
LLPHGYEGQGPEHSNARPERFLQLSAEYNMVVANITEPSNFFHLLRRQLAWEFRKPCIVM
SPKSLLRHPKVVSPIDEFTKGGFREVLNDTTVKKTDVTRVVLCSGKIYYDLIEAREKEKV
KDVAIVRVEQLHPLPEKQIVEVVKSYSKNKEVVWVQEEPENMGYWTYMMRALFRDFPMDV
IARKASASPATGYFKVHQEEQEHIINKALKIK
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatattcatacatttccaatgcccatgtagcttatatcgatgagttatatgag
gattacaaaaaagacccagaatcaatcgagccaagttggaagacattttttgatggattt
gactttgccattaccaagtttggagaagatgaggatggaggagccgtaagcggtggtagc
tccaatggggcagccaaaaacggggcacttgctacaaaaggcaccattatggacatggag
caattgccaaaggaaatcaaagtgagggcattgattcatgcctatcgctcccgggcgcac
cttcgctccaaaaccaaccctgtgcgggaaagaagggaccgaaaggcattgatcgacctg
gaggattttgggttgagtgaagcagatctgaataccgagtttcaagcaggaaacgaaatc
ggaatcggcgatgctaaattgagcaaaatcctggagtcgcttagaaagatttatgaaggg
acgatgggcttcgaatacctgtatatccgggatccggaaatgttggattggttcaggcag
aaaatcgaaaaagaagccttagcctttaacccacccgatgaggaaaagaagcgcattcta
tataaattgaatgaggctgttgtatttgagaatttccttcatacaaaatatttaggacaa
aagcgcttttcgttggaaggcggagagagtaccatcccgttcttggatgcggtgatcaac
aaatcggcagatttaggagcagaggaagtgatgatcggcatggcccaccgtggccgcttg
aatgtcttggccaatgtcatggggaaaacgtatgagcagattttctctgaatttgaagga
acagccaagccagacctcaccatgggagacggcgatgtgaaataccatatgggcttttcc
agtgaaatcactacccctagcgataaaaaaatcaacttgaaattggccccgaacccctct
caccttgaggcggtaaatcctgtagtcgaaggatttgtaagggcgaaaatcgatcaccaa
tatgaaggtgataaagacaaagtggtgccaatcctcatccatggtgatgcggcagtggcc
ggacaaggcattgtctatgaggtcacgcagatggctaacctgaaaggctataatacggga
gggaccatccactttgtgatcaacaaccaagtgggctttacgacggactttgatgatgcc
cgtagctccatctactgtacagatgtagcaaagatcatcgatgcgccggtgatccacgtg
aatggagacgatccggaagccgtcgtttttgcggccaaattggcggctgacttcaggcaa
agatacaatcaggacatcttcattgacatggtttgctaccgtcgccatggccataacgag
tctgatgagccgaaatttacccagccaaacctctacaatattatctccaagcaccccaac
cctcgggaaatctataacaaagagctgatggagaggggcgatgtggacgccaagctggcc
aagcaaatggacaaggagtttaggaagctcctacaggataggctaaacatggtgaaagag
aagccgcttccctacaagtcctcgccttttgagcaggcttggaaggagctgagaaaatca
gaaccagcggattttgacaagtctcctgatacctatatttctgaagaggcgatcgaaaaa
gtggccgaagcccttacctctttgccaaaaggcttcaagccgatcaagcaaatcgaagcc
cagatgaagcagcggaaggacatgttctatagttccaagtcccttaactgggcagctgcg
gagttgttggcgtatggttcattgttgctggagggcaagaccgtccgactgaccgggcag
gactgtagaaggggcactttttcccaccgtcacgcagtgcttcatgatgcaaataccaac
aagtcctacaattccctgaaggaaatgaaggacaataaaggtcaattccacatttataat
tcccttttatccgagtacgctgtacttggttttgagtatggatatgccatggccaacccg
aatgcattgaccatttgggaggcgcaatttggggattttgccaacggcgcacagaccatg
atagaccagtttatcagttctggggagtccaaatggcaaaagatgaatggattggtaatg
ctgttgcctcacggatatgagggacagggcccggagcactccaatgcccgtcctgaacgg
tttttgcagctatccgccgagtataacatggtggtggcaaacatcacagaaccgtcaaac
ttcttccacctgctcagaagacaattggcatgggagtttagaaagccatgtatcgtgatg
tctcctaaatcactgttgagacatcctaaggtcgtttccccgatcgatgagttcaccaaa
ggtggcttcagggaagtgctgaatgatacgactgtcaagaagacagatgttaccagggta
gtgctctgttcaggaaaaatctattatgatcttatcgaggccagggaaaaagaaaaagtg
aaagatgtggccatcgtcagggtggagcagcttcatccacttccggagaaacagatcgtg
gaggtggtgaagtcttacagcaaaaacaaggaagtagtttgggtgcaagaggagccggaa
aatatgggctactggacgtatatgatgcgtgcattgttccgtgacttccctatggacgtt
attgctcgaaaagccagtgcctcccctgctacaggttactttaaggtacaccaagaagag
caggaacacattataaacaaagccttaaaaatcaaataa

DBGET integrated database retrieval system