KEGG   Echinicola vietnamensis: Echvi_1449Help
Entry
Echvi_1449        CDS       T02388                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
evi  Echinicola vietnamensis
Pathway
evi00380  Tryptophan metabolism
evi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Echvi_1449
Enzymes [BR:evi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Echvi_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGA77715
UniProt: L0FYK0
LinkDB All DBs
Position
1661593..1662873
Genome map
AA seq 426 aa AA seqDB search
MSSYRYSLAFAQERDREDPLRKFQSRFHFPKVNGEAAIYFCGNSLGLQPKAVREHLDRDL
ESWASKAVDGHFEGDAPWFSVHERSKAALAEIVGAKKHEVVAMGSLTTNLHALLVSFYQP
NGKRNKILTEAGAFPSDMYALESQVKYHGLDPDEAIVEVGPRPGEHTIRTEDILQAISKH
QDELACVMMAGLQYYTGQVFDMKAIASAAHAVGATVGFDLAHAAGNAPLHLHDWGVDFAA
WCSYKYLNSGPGNVAGIFVHERHGNNPALNRFAGWWGHDEKVRFKMEKGFVPMYGADGWQ
NSNGNVLGMAAHQASLDIFQEAGMVHLRKKSVQLTGFLAFLIREISGESGVLEVITPNAE
AERGCQLSLLIHKGGKAVFDEFYQNGIVGDWRNPNVIRIAPTPLYNSFEDVFRFAKILEQ
SLSKFA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcataccgctacagcttggcctttgcccaagagagggaccgtgaggatcccctg
aggaaattccaaagtcgctttcactttcctaaagtaaatggggaagcggccatttatttt
tgtggcaattccctcggacttcaaccaaaagcggtcagagaacaccttgatcgagacctg
gaaagttgggccagcaaggcggtggacggacattttgaaggggatgcgccatggttttcc
gtgcatgaaaggtccaaagcagcgctggcggagattgttggtgcgaaaaagcatgaggtg
gtcgccatgggaagtttgaccaccaacctccatgccctgttggtctctttttaccaaccc
aacggaaaacgaaacaagattctgacagaagcgggtgcgttcccttcggacatgtatgcg
ctggaatcccaggttaaataccatggactggaccccgatgaagcgatagtggaagttggg
ccacgaccgggagagcatacgatcagaaccgaagatatccttcaagcgatctccaaacat
caagatgagttggcctgtgtgatgatggcaggcttgcagtattatacgggccaggttttt
gacatgaaggccatcgccagtgctgcccatgcggtaggggctacggtaggctttgatcta
gcgcatgcagcaggtaatgctcctttacatttgcatgactggggagtggattttgcggcg
tggtgcagctataagtatttgaattctggtccaggaaacgtggcggggatttttgtacat
gagcggcacggcaataatccggccctcaatcgatttgctggctggtggggacatgatgag
aaagttcgctttaagatggaaaagggctttgtgcccatgtatggtgcagatggttggcaa
aactccaatggaaacgtccttggcatggcagcccaccaagcttccttggatatcttccaa
gaagcagggatggtgcatttaaggaaaaagagtgtgcaactgacaggctttttagctttt
ttgatccgtgagataagtggtgaaagtggtgtgttggaagtgattaccccaaatgccgaa
gcggaaagggggtgtcaattgtcattgctgatccacaaaggcggaaaagcggtctttgat
gagttttatcagaacgggattgtgggggattggcgaaatcccaatgtaatcaggatagca
ccgacccctctttacaatagctttgaggatgtgtttagatttgccaaaatactggaacaa
tccctttcaaaattcgcttaa

DBGET integrated database retrieval system