KEGG   Echinicola vietnamensis: Echvi_1460Help
Entry
Echvi_1460        CDS       T02388                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
evi  Echinicola vietnamensis
Pathway
evi00240  Pyrimidine metabolism
evi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Echvi_1460
Enzymes [BR:evi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Echvi_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AGA77726
UniProt: L0FY89
LinkDB All DBs
Position
complement(1673816..1674400)
Genome map
AA seq 194 aa AA seqDB search
MFIEPVIGNNTLKDKKGHIEVICGSMFSGKTEELIRRLNRALIAKQKVEIFKPSLDTRYH
DRDVVSHNETVIRSTPVQFADDIMLLAGDCDVVGIDEVQFFDKQIVHVANKLAIAGKRVI
MAGLDMDFEGKPFDPMPQLLASAEYVTKVHAICMKCGDLASYSYRLTPAKEKVVLGEKDN
YEARCRTCFYETKS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgttcatagaacccgtcataggaaataatacccttaaagataaaaaggggcacatagaa
gtaatctgcggatcgatgttttctggtaaaacagaagaactcatccggcgcctgaacagg
gccctcattgccaagcaaaaggtggaaatcttcaaaccttcccttgatacgcgctaccat
gatcgtgacgtcgtttctcataatgaaacggtgatcaggtccacgcccgtccagtttgcc
gatgacatcatgcttttggccggtgactgcgatgtcgtgggcatcgatgaagtccaattc
ttcgataaacaaatcgtccatgtcgccaataaactggccatcgccggtaaacgcgtgatc
atggctggtttggatatggactttgagggaaaaccctttgatcctatgcctcagctgttg
gccagtgctgaatacgtcaccaaggtacatgcgatctgcatgaaatgtggcgacctcgcc
tcctacagctaccggctcactcctgcaaaggaaaaggtcgtgctgggagaaaaagacaac
tatgaggctcggtgcagaacgtgtttttacgaaaccaagtcctag

DBGET integrated database retrieval system