KEGG   Echinicola vietnamensis: Echvi_1669Help
Entry
Echvi_1669        CDS       T02388                                 

Definition
(GenBank) beta-galactosidase/beta-glucuronidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
evi  Echinicola vietnamensis
Pathway
evi00052  Galactose metabolism
evi00511  Other glycan degradation
evi00600  Sphingolipid metabolism
evi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Echvi_1669
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Echvi_1669
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Echvi_1669
Enzymes [BR:evi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Echvi_1669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 DUF4846
Motif
Other DBs
NCBI-ProteinID: AGA77934
UniProt: L0FVL1
LinkDB All DBs
Position
1945400..1947886
Genome map
AA seq 828 aa AA seqDB search
MSYFTYNFNGTVKGQIINTMQKFLSFILVFSLAVVSWNCASSEDKERQVIDFNYGWRFQL
GDHPNAISEDFDVSNWRELNLPHDWSIEGDFSEDHPTKPEGGALPAGIGWYRKAFKLPTE
AKEQSIWIEFDGVYRNGEVWINGHRLGKRPNGYSSFKYDLGEHLNYGDKVNVLAVRVDNS
EQPNSRWYTGSGIYRNVRLIRTGKVHVEHWGTYVTTPEITDSSAVVNLEVMVKNDGFNER
KLTVRSTILDADGEAVTEEEQPLVLGKGESTDVTQRFTVPSPKLWSTDEPYLYQVVTQVY
AGMQLMDDYVTPLGIRYFNFDAQKGFSLNGKRMKILGVCNHHDLGALGAAVNKRAIERRL
EILKEMGVNAIRTAHNPPAPELLQLCDEMGFIVQDEAFDVWKKKKVDADSHLFWDQWHRR
DLEDLILRDRNHPSIMMWSIGNEIREQFDSTGISITKELVRIVKELDTTRVVTCALTENI
PSKNFIYQSKALDLLGFNYKHKDHKNFPKWYPGEKLIATENMSALATRGHYDLPSDTIMR
WPQAHDKPLETGNEDLTVSAYDQVSAYWGSTHEETWKSIKDQDFMAGLFVWTGFDYLGEP
IPYPYPARSSYFGIVDLAGFPKDAYYMYQSEWTADTVLHVFPHWNWEAGQEVDVWAYYNQ
ADEVELFLNGESLGIKQKEGDDLHVMWRTPFEPGTLKAVARKDGKKVAEKKVTTAGDAQK
VTLSPDRKTIKADGKDLSFITVSICDMDGNIVPNADNMVNFEIQGEGKIMGVDNGYQASL
EPFKANYRKAFKGKCLLIVQSAREAGEISIRATSEHLQPGEIVLETVD
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctattttacctataactttaatgggacggttaaaggccaaataataaataccatg
caaaaattcctgagttttatccttgtgttttccctggcagtggtcagttggaattgtgct
tcttctgaagacaaggaaaggcaagtcattgactttaattatggttggcgctttcagttg
ggagaccatcccaatgcgatcagtgaggactttgatgtgtccaattggcgggaactgaac
cttccgcatgattggagcatcgaaggggatttcagtgaagatcacccgaccaagccagaa
gggggagccctgccagcaggaatcgggtggtacaggaaggcctttaagttgcccactgaa
gcaaaggagcaaagcatttggattgagtttgacggggtgtatcgcaatggagaggtctgg
atcaatggtcaccgcctaggaaaacggccaaacggttacagttctttcaagtatgaccta
ggggaacatttgaattatggcgacaaggtaaatgttttggccgtgcgtgtggacaattcc
gaacagcccaactcccgttggtatactggctcgggaatttaccgaaatgtgcgccttatc
cgcaccggaaaagttcatgtggagcattggggaacctatgtcaccacgccggaaatcacg
gattcttctgctgtggtaaacttagaagtaatggtcaagaatgacggcttcaatgagcgg
aagttaacggtgcgatcgaccattttggatgcagatggtgaagcggtcacggaggaggag
caaccgttggtactcggcaaaggtgaaagtactgacgtcacccagcgttttaccgtacct
tcacccaaactatggtccactgacgagccttatttgtatcaggtggtgacacaggtatat
gcagggatgcaattaatggatgactatgtgacccccctggggattcggtattttaatttt
gatgcccaaaaaggtttttcccttaacgggaagcggatgaagatcttgggcgtttgtaat
caccatgacctgggtgccttgggagcagcagtcaataaacgggcgattgagcggcgactg
gaaatcctgaaggaaatgggcgtcaatgccatcaggaccgcgcacaatcccccagcacca
gagctgttgcagctatgtgatgagatgggcttcatcgtacaggacgaggcttttgacgtg
tggaaaaagaaaaaagtggatgccgatagtcatttgttttgggaccaatggcaccgcagg
gatttggaggatttgatcttgcgggatagaaaccatccgtccatcatgatgtggagcatt
ggcaatgagatccgagagcagtttgacagcacgggcatcagcattaccaaggaactggta
aggatcgtaaaagaactggatacgacgcgggtggtgacctgtgcgttgaccgagaatatt
ccctcaaagaactttatttatcaatcaaaagcactggacttgctgggctttaattacaag
cacaaagaccataaaaactttccaaaatggtatcccggggaaaagctgattgccacggaa
aacatgtctgcgttggcgacccgtggacattatgacttgccatcggataccatcatgcgg
tggcctcaggcccatgacaagcctttggaaacaggaaatgaagatttgaccgtttcggcc
tatgaccaagtttcggcctattggggcagtacgcatgaagagacctggaaatccatcaag
gaccaagattttatggctggattgtttgtttggacaggctttgattacttgggcgagcca
attccttacccttatccagcaaggagttcctatttcggtatcgtggatttggcaggattt
cccaaggatgcctactacatgtatcaaagtgaatggacagctgatacggtgctgcacgta
tttccgcattggaactgggaagctggccaagaggtggacgtatgggcttattataaccaa
gccgatgaagtggaattgttcctgaacggagaatcgttaggaatcaagcaaaaagagggg
gacgacctgcatgtcatgtggcgtactccttttgagccgggaacgctgaaggcggtagcc
cgtaaggacgggaagaaagtggcagagaagaaggtgactactgcaggtgatgcccaaaaa
gtaaccctttcacccgatcggaaaaccatcaaagcggatggaaaggacctttcgtttatc
acggtgagcatttgcgatatggacggaaatatcgtgcccaatgcagataatatggtcaat
tttgaaattcagggagaggggaagattatgggggtagacaatggctatcaggccagcttg
gaaccgtttaaggcaaattatcgcaaagcttttaaaggaaagtgcttgttgatcgtccag
tccgccagagaggcaggcgagatttccattcgggccacttcagagcatctccagccaggg
gagattgtcttggagacggtggattga

DBGET integrated database retrieval system