KEGG   Echinicola vietnamensis: Echvi_1766Help
Entry
Echvi_1766        CDS       T02388                                 

Definition
(GenBank) ATP synthase, F1 beta subunit
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
evi  Echinicola vietnamensis
Pathway
evi00190  Oxidative phosphorylation
evi01100  Metabolic pathways
Module
evi_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Echvi_1766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:evi00194]
    Echvi_1766
Enzymes [BR:evi01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     Echvi_1766
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     Echvi_1766
Photosynthesis proteins [BR:evi00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Echvi_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N T3SS_ATPase_C NACHT RsgA_GTPase AAA_19 NB-ARC DUF1858 AAA_7 AAA_16 RNA_helicase TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: AGA78031
UniProt: L0FZ77
LinkDB All DBs
Position
2075206..2076708
Genome map
AA seq 500 aa AA seqDB search
MANTGKITQVIGPVVDISFEGGKLPNILDALEITKENGQKVVLEVQQHLGEDRVRTIAMD
SSEGLRRGLEVIDLGAPISVPTGEGIKGRLFNVVGEPIDGLPAVESTTKLPIHRHAPKFE
DLSTSTEVLYTGIKVIDLIEPYAKGGKIGLFGGAGVGKTVLIQELINNIAKAYSGLSVFA
GVGERTREGNDLLREMIESGIVTYGDDFVESLENEGGWDLSKVDVEKLKESKATFVFGQM
NEPPGARARVALTGLTLAEYYRDGEGDGAGKDILFFIDNIFRFTQAGSEVSALLGRMPSA
VGYQPTLATEMGAMQERITSTKHGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRK
IAELGIYPAVDPLDSTSRILEPGILGDEHYGCATRVKELLQRYKELQDIIAILGMEELSE
EDKLVVHRARRVQRFLSQPFHVAEQFTGLKGVLVDIKDTIKGFNMIMDGELDHLPEAAFN
LVGDIDDAIAKGEKMLAEVK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatactggtaagataactcaggtgattggccccgtagtagatatttctttcgaa
ggggggaagttgccgaatatcctggacgcactcgaaatcactaaggagaacggtcaaaaa
gtagtattggaggttcagcagcacttaggagaagatcgtgttagaacgattgcaatggat
tcttccgaaggcttaagaagaggcttggaagtgatcgatttaggcgctccgatctctgta
cccacaggagaaggcatcaaaggccgacttttcaatgtagtaggagagcctatcgacggc
cttcctgcagtagagtccactaccaagcttcctatccacagacacgctcctaagttcgaa
gacctttctacttcgacagaggtgctgtatacaggtattaaagttatcgacttgatcgag
ccttatgcaaaaggtggtaaaattggtcttttcggtggtgccggtgtaggaaagacggta
ttgatccaggagttgatcaataacatcgccaaagcttactctggtctttcggtatttgcc
ggggtaggagaaagaacccgtgaaggaaatgaccttcttagagagatgatcgaatcaggt
attgtgacttacggtgatgatttcgtagaatctcttgaaaatgaaggtggctgggatctt
tctaaagtagacgttgaaaaattgaaggagtccaaagcaacctttgtgtttggtcagatg
aatgagcctccaggtgcccgtgcacgtgtggcattgactggtcttacacttgctgaatat
taccgagacggtgaaggcgatggtgctggtaaggatatccttttctttattgataatatt
ttccgatttacccaagcaggttctgaggtgtcagcccttctgggacgtatgccatctgcg
gtaggttaccagcctacattggcaacagaaatgggtgccatgcaggagagaattacctct
accaagcacggttccattacttccgtacaagccgtttacgtacctgcggatgacttgact
gaccccgctccagcaactacgtttgcccacttggatgccactacggtactttcccgtaaa
atcgccgagctaggtatttatcctgcggtggatcctttggattctacttctaggattttg
gagccaggcattctgggtgacgagcactatggatgtgctacgcgcgtaaaagaattgcta
cagcgttataaagaacttcaagatatcattgccatccttggtatggaagagctttctgaa
gaagataagcttgtcgtacacagagcaagaagggtacagcgtttcttgtcccagccattc
cacgtagccgagcagtttaccggattgaaaggggtgttggtagatatcaaagataccatc
aaaggatttaacatgatcatggacggtgaacttgatcatcttcctgaagcagcatttaac
ttggtcggtgacattgatgatgccatcgctaagggtgagaaaatgcttgccgaggttaaa
taa

DBGET integrated database retrieval system