KEGG   Echinicola vietnamensis: Echvi_1771Help
Entry
Echvi_1771        CDS       T02388                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
evi  Echinicola vietnamensis
Pathway
evi00564  Glycerophospholipid metabolism
evi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Echvi_1771
Enzymes [BR:evi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Echvi_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox Thi4 Pyr_redox_3 Lycopene_cycl NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AGA78036
UniProt: L0FZ81
LinkDB All DBs
Position
complement(2080750..2082315)
Genome map
AA seq 521 aa AA seqDB search
MNRAHNLRPLAKNQLWDIVIIGGGASGLGVALDALSRGLSVALFERADFAKGTSSRSTKL
VHGGVRYLAQGDILLVWEALRERGRILKNAPHLAHAQPFIIPIYSHATKYYYTVGLKFYD
WMSGWLSLGDSSFISKKETIKRLPEIKTEGLLGGVVYHDGAFDDARLAIAVAQTCDDMGG
CILNYMKVTSLTKDGAGIITGVKVRDAIHKKSYDVKAKMVVNATGVFADKILQMDQKGAP
RMIQPSQGVHLVLPQHFLGGQDALMIPKTSDGRVLFAVPWQGKLVVGTTDTIRAKTKMEP
EALSREINFILANAGQYLSKKPTRKDVLTVYAGLRPLAAPKGESVKTKEISRNHKVIISD
SGLTTLTGGKWTTFRKMGEDTVDHFPRVTGEEIKESHSWEIKLHGHGDPTLDDKHWKIYG
TDAVKILQLIKENPPYAKLLHPQYPYVAGEVIWAIREEMAMHIEDFLARRIRILLLDAAA
AIAMAPLVASLMAAELKKDKNWIDNEVSAFTKIAEKYLIKP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagcccataacctccgccctttagcaaaaaatcaactttgggatattgtcatt
attggtgggggcgcttccgggttgggagtggcgctggatgcactatcaagagggttgagc
gtagcactttttgaaagagctgattttgcaaaaggcacttccagtagaagcactaaattg
gtgcatggtggcgtcaggtacctggcacaaggcgatattttgctggtatgggaagccctt
cgggagcggggaaggatcttaaaaaacgctccgcacttggcccatgcccagcccttcatc
attcccatttacagtcatgccaccaagtactactacaccgttggcctgaagttttatgat
tggatgtccggctggctcagcttaggagactccagctttatttcaaagaaagaaaccata
aagcggttaccagaaataaaaacagaaggattactaggtggtgtcgtgtatcacgatgga
gcgttcgatgacgcccgcctggccattgcggtagctcaaacgtgtgatgacatgggcgga
tgcatcctcaattacatgaaagtaaccagccttaccaaagacggtgcgggcatcataacc
ggtgtcaaagtaagggatgccatccataaaaagagctatgatgtgaaagcgaaaatggtg
gtaaatgccacgggggtttttgcggataagattttacagatggatcagaaaggagccccc
agaatgattcagcccagccaaggagtacacttggtattgccgcagcatttccttggcggc
caagacgccctgatgatccccaaaacctccgatggcagggtgttatttgctgtcccatgg
caaggaaaacttgtcgtgggcacgaccgataccattcgcgccaagaccaaaatggaaccg
gaagccctttcccgtgaaatcaatttcatcttagccaatgcaggacaatacttgagcaaa
aaaccaacgagaaaagacgtcctgaccgtttacgcaggattgcgcccccttgccgcgcca
aagggagaaagtgtaaagacgaaagaaatatctagaaaccacaaagtcatcatttccgat
tccggcctgaccaccctcacgggaggaaagtggaccacattccgcaaaatgggagaagac
acggtggaccatttcccacgagtcaccggggaggaaataaaagaaagtcattcttgggag
atcaaacttcacggccatggtgaccctacattagatgacaaacactggaaaatttatgga
acggatgctgtgaaaattctccaactcatcaaagagaatccgccatacgccaaactgctc
catccccaatatccctatgtagccggagaggtgatttgggctatcagggaagaaatggcc
atgcatatagaagatttccttgcgagaagaatccgtatcctcctgctggatgctgcggct
gccatagccatggctcccttggtggcctcactcatggccgcagagctcaaaaaggataaa
aactggatagataacgaagtcagtgcatttaccaaaatcgctgaaaaatatttgatcaaa
ccataa

DBGET integrated database retrieval system