KEGG   Echinicola vietnamensis: Echvi_1772Help
Entry
Echvi_1772        CDS       T02388                                 

Definition
(GenBank) hypothetical protein
Organism
evi  Echinicola vietnamensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMP_b-brl BBP2_2
Motif
Other DBs
NCBI-ProteinID: AGA78037
UniProt: L0FXN2
LinkDB All DBs
Position
complement(2083178..2083792)
Genome map
AA seq 204 aa AA seqDB search
MKHITLVIAFITLIPLTSFSQSREGTDRLYKPFKVDASINLTFPTASDLTTGGGFFVEPR
YGINDHFNIGLQLGSNILGEGESLFNHQEATYRAQAISNLSLTGEYLFGKENTRPFVGIM
AGMYRRSDYEIVDSDDGTIFNKEGNEVNFGFAPRIGVLTGKFRMNVTYHVTGQNISNFIS
IGLGIQFGGGRIKNEPKKNYSTWE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacatcacactggtcattgcttttatcaccctgattcctttaacgtctttttct
caatcccgagaaggaacggatcggttatacaaaccttttaaagtcgatgccagtattaac
ctcaccttccctacagcatccgatcttaccacgggaggaggtttttttgtggaaccgcga
tatggtattaatgaccactttaatataggactccagctcggaagcaatattctgggagaa
ggtgaatcgcttttcaaccaccaagaggccacttacagggctcaggccatttccaatctt
tccttaaccggtgaatacctctttggaaaagaaaatacccgcccatttgtgggcatcatg
gccggaatgtaccgaagaagcgattatgaaatcgtggattctgacgacggcaccattttt
aacaaagaaggaaatgaagtgaactttggctttgccccacgaataggggtattgacaggg
aagtttcgcatgaatgtcacctaccatgttaccggtcaaaacatcagtaactttatcagc
attggattgggcatccaatttggcgggggtaggatcaaaaatgaacccaagaaaaattat
agtacttgggaatag

DBGET integrated database retrieval system