KEGG   Echinicola vietnamensis: Echvi_2206Help
Entry
Echvi_2206        CDS       T02388                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
evi  Echinicola vietnamensis
Pathway
evi00970  Aminoacyl-tRNA biosynthesis
evi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Echvi_2206
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:evi03029]
    Echvi_2206
Enzymes [BR:evi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Echvi_2206
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Echvi_2206
Mitochondrial biogenesis [BR:evi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Echvi_2206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AGA78456
UniProt: L0G0C1
LinkDB All DBs
Position
complement(2634589..2634876)
Genome map
AA seq 95 aa AA seqDB search
MKIDINTLKKIAHLARLEFDENSAKKMTRDMTQILDWVEHLEQVDTEGVAPITTMSSEVN
VLREDAVGSHLSHEKGLKNAPQKDSDYFRVPKVLE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgatatcaatacgttaaaaaaaatcgcccaccttgcccgccttgagtttgac
gaaaacagcgccaagaaaatgacccgcgacatgactcaaatcctggactgggtggagcac
ctggagcaagtggacactgagggagtagcccctattacgaccatgtcttccgaagtaaat
gtacttcgtgaagatgccgttggaagccacctgtctcatgaaaaaggccttaaaaacgcg
ccacaaaaggactctgattacttccgtgtgcccaaggtgctagaataa

DBGET integrated database retrieval system