KEGG   Echinicola vietnamensis: Echvi_3727Help
Entry
Echvi_3727        CDS       T02388                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
evi  Echinicola vietnamensis
Pathway
evi00620  Pyruvate metabolism
evi00680  Methane metabolism
evi01100  Metabolic pathways
evi01120  Microbial metabolism in diverse environments
evi01200  Carbon metabolism
Module
evi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Echvi_3727
  09102 Energy metabolism
   00680 Methane metabolism
    Echvi_3727
Enzymes [BR:evi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Echvi_3727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGA79939
UniProt: L0G151
LinkDB All DBs
Position
complement(4432154..4434703)
Genome map
AA seq 849 aa AA seqDB search
MSNTYQTEVAKRFTIYNSLFLDLPFDDIYRTGTLLPILSSECKKGFAEGKTPKEIINSFF
EGMLASNSSKEKHNLLFQLVQYVERQVVLFDSIEDAAFEKINDVKGKGTMNALISRVESD
KKKAELIEKLRTFSIRLTLTAHPTQFYPGNVLAIITDLESAIRKDDLGSIDALLRQLGKT
AFINKEKPSPYEEAVSLCWFLEHVFYKSIPDIMARVLRKLDIPLHEWDNPDLLKVGFWPG
GDRDGNPFVTHQITMDVADKLQETILRCLYRDVRKVRRRMTFKGVESLMLEAENGIYKTL
YGGEKVLKSKEDLLKILLKAREIIIESHDGLFLDILDEFILKVNVFGFYFASMDMRQDSR
KHAALWEEIIEVTKGKDALKKYQEGTEKEQIETILSFTELPNPKTLKDEFHQEMLESIAS
ISYVQDNNGSEGLHRYIISNCQSELHILQVYQLNKLTLAPKGDLKLDIVPLFETIDDLAA
APEIMERLYSNPVYGGHLKSRGNKQSIMLGFSDGTKDGGYIRANWSILRAKEELTKASRK
YEVSVVFFDGRGGPPARGGGNMHNFYASLGDQVENEEIQVTIQGQTISANYGKPVSCTYN
LEQLLSAGLENHLYPTEENRLTDDQRALIDEMADISYQAYKEFKSHPQFVSYLEKVTPLK
FFGKTNIGSRPLKRSKGEAMKFEDLRAIPFVGSWAQMKQNIPGFYGVGKAITEMEKRGKK
DQVTKLYQDSLFFRSLMGNSMQSLAKSYYPATAYLKNDKEYGEFWELMHSEYQQSFKKIL
EISGMHELLEDNAVSSQSIAIREKIVLPLITIQQYAIQEMLETGKENTVLQKLILRTMFG
IINAARNAA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatacctaccagactgaggtagccaagcggtttaccatttacaacagtttattt
ctagacttgccttttgatgacatctaccgaacggggacgttgcttcccattttatcttcg
gaatgtaaaaaaggttttgccgaggggaaaaccccaaaagagattatcaactcgtttttt
gagggcatgttggcctctaattcatccaaagaaaaacacaatttactgtttcagctggtt
caatatgtagaaagacaggtggttctttttgactctattgaagatgctgcattcgagaaa
atcaatgacgtaaagggtaaaggtaccatgaacgccttgatttcccgagtggaaagtgac
aagaagaaggccgagctcatcgaaaagctgaggacgttctccattcgcctgaccctgaca
gctcaccctacacagttttatccgggcaatgtactggccatcatcaccgatctggaatcg
gccattagaaaagatgatttgggcagcattgatgccttgctgcggcaattgggcaaaacg
gcctttatcaacaaggaaaagccatccccttatgaggaggctgtcagcttgtgctggttt
ttggagcatgtcttttataagagtattccggatatcatggccagggtgctcagaaagctg
gacatccctctgcacgaatgggacaacccagacctgctcaaagtaggtttttggccaggc
ggtgaccgtgatggcaatcctttcgtgacgcatcagattaccatggacgtagcggataaa
ttgcaggaaacgatccttaggtgtctttaccgggatgtgcggaaagtgagaagaagaatg
accttcaaaggagtggaatccttgatgctggaagcggaaaatggcatttataagaccttg
tacggaggagaaaaagtgctgaaatccaaagaggacctgctgaagatccttttgaaagca
agggagattatcattgaatcccacgacgggcttttcttggatatcctggacgaatttatc
ctgaaggtaaacgtgtttggcttctatttcgcttccatggacatgcgccaggacagtaga
aaacacgccgccctttgggaagagatcattgaagtgaccaaggggaaagatgccctgaag
aaataccaggaaggcaccgaaaaagagcagatcgaaacgatcctttctttcacggaattg
cctaaccctaaaaccctgaaggatgagttccatcaggaaatgttggaaagcattgcttcc
atcagctatgttcaggacaataatggcagtgaaggccttcaccggtacattatttccaac
tgtcaatcggaattgcacattctgcaagtatatcagttgaacaagcttacattggctccc
aaaggagacttgaaactggatatcgtgcccttgtttgaaaccatcgatgacttggcagcg
gcaccggaaatcatggaacgcctatattccaaccctgtatacggtggccacctgaagtcc
agaggcaacaagcaaagcatcatgctgggcttctctgacggtaccaaagatggcgggtat
atccgagcgaactggtccatcttacgcgccaaagaggaactcaccaaggcttccagaaag
tatgaagtgagtgtagtgttctttgacggtcgaggaggacctccggccagaggtggcgga
aacatgcacaacttctacgcttcactgggagaccaagtggaaaatgaggaaatccaagtg
acaatccaggggcaaaccattagtgccaactatggcaaaccggtttcttgtacctataac
ttggagcaactgctcagtgcaggattagaaaaccacctgtatccgaccgaagaaaacagg
ctgacagatgatcagcgggctttgatcgatgagatggccgatatcagctatcaggcttat
aaagaatttaagagccatccgcaatttgtgtcgtacttggaaaaagtgacgccattgaaa
ttctttggcaagaccaatattggttcacgtcctttgaagcgaagcaaaggggaggccatg
aagtttgaagacctgagggccattcctttcgtgggatcttgggcgcagatgaagcaaaat
attccaggtttctatggagtcggaaaagccattaccgaaatggaaaaaagaggcaagaag
gatcaggtaaccaagctttaccaagattctcttttcttccgctctttgatgggcaattcc
atgcaatcactggcaaaatcttattatcctgccacagcttatttgaaaaacgataaggaa
tacggtgagttttgggagttgatgcattcggagtaccagcaatctttcaaaaagatattg
gaaatatccggcatgcatgagcttttggaggacaatgctgtcagcagccaatccatagcc
atccgggaaaagattgtattgcctttgattaccattcagcaatatgccattcaggaaatg
ctggaaaccggtaaagaaaatacggttttacaaaaactgatcttgagaacgatgtttggt
attatcaatgccgcaaggaacgcggcctga

DBGET integrated database retrieval system