KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_01215Help
Entry
BFV63_01215       CDS       T04821                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Brite
KEGG Orthology (KO) [BR:exf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:exf03012]
    BFV63_01215
   03029 Mitochondrial biogenesis [BR:exf03029]
    BFV63_01215
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:exf04147]
    BFV63_01215
Translation factors [BR:exf03012]
 Eukaryotic Type
  Elongation factors
   BFV63_01215
 Prokaryotic Type
   BFV63_01215
Mitochondrial biogenesis [BR:exf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BFV63_01215
Exosome [BR:exf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BFV63_01215
  Exosomal proteins of breast cancer cells
   BFV63_01215
  Exosomal proteins of colorectal cancer cells
   BFV63_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AOP89585
UniProt: A0A2U9H3C3
LinkDB All DBs
Position
244382..245566
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgtactggctaaaacctac
ggcggtgctgctcgtgctttcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacttctcacgttgagtatgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgatggccctatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccttacatcatcgtgttcctgaacaagtgcgacatg
gttgatgacgaagagctgctggaactggtagagatggaagttcgtgaactgctgtctcag
tacgatttcccaggcgacgacactccaatcgttcgtggttccgcgctgaaagcgctggaa
ggcgatgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccagaaccagagcgtgcgattgacaagccattcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggttctggcgaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtacattctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacatcaagatggtt
gtgactctgatccacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctcggctaa

DBGET integrated database retrieval system