KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_01625Help
Entry
BFV63_01625       CDS       T04821                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00480  Glutathione metabolism
exf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BFV63_01625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:exf02000]
    BFV63_01625
Enzymes [BR:exf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BFV63_01625
Transporters [BR:exf02000]
 Other transporters
  Pores ion channels [TC:1]
   BFV63_01625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AOP89660
UniProt: A0A422XA68
LinkDB All DBs
Position
338010..338681
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNQSRSHRVLWALEELGLTYDIVRYQREKTMLAPDSLKKVHPLGKSPVLEDNGL
VLAESGAILEYLQETYDSASRFKPLDPAHKVQYRFWLHYAEGSLMPLLLMKLVFNSLGKP
PVPFGLRTLGKALGQGVQKAYLNRQLETHARFINDHLAENSWFAGDTLTMADIQMSFPLF
ALLARGGIDNLDHIAAWKQRVEARPGWQTTLAKGGPLTIPGEG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctaacggtccaccaccttaatcagtctcgttcacatcgtgtcctctgggcgctggaa
gagctgggtctgacgtacgacatcgtgcgctaccagcgtgaaaaaaccatgctcgcgcca
gactcgctcaaaaaagtgcatccgctgggaaaatccccggtactcgaagataacggactg
gttctggccgaatcaggtgcgattctggaatatcttcaggaaacgtacgattcggcgtca
cgattcaaaccgttagatcccgcccataaagtgcagtatcgcttctggctgcattacgcc
gaagggtctttgatgccgctactgttaatgaagctggtgtttaacagcctcggcaaacca
cccgtcccgtttggcctgcgcacgctgggtaaggcgctggggcagggggtgcaaaaagcg
tatctcaaccgccagctggaaacgcatgcgcgctttattaacgatcatcttgccgaaaac
agctggtttgccggcgacacgctgaccatggctgatatccagatgagttttcccctcttc
gccctgctggcgagaggcggcatcgacaatctcgaccacatagcggcgtggaaacagaga
gtggaggcacgtccgggctggcagacaacgcttgcgaaaggcggcccactgacgatcccc
ggcgagggatga

DBGET integrated database retrieval system