KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_03610Help
Entry
BFV63_03610       CDS       T04821                                 

Definition
(GenBank) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00550  Peptidoglycan biosynthesis
exf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BFV63_03610
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BFV63_03610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:exf01011]
    BFV63_03610
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:exf03036]
    BFV63_03610
Enzymes [BR:exf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BFV63_03610
Peptidoglycan biosynthesis and degradation proteins [BR:exf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BFV63_03610
Chromosome and associated proteins [BR:exf03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BFV63_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AOP90032
LinkDB All DBs
Position
752936..754702
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTLKPKRQEEQANFVSWRFALLCGCILLALGFLLGRVAWLQIIAPDMLVRQGDMR
SLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKELHDAGGITLDNRWKALSDALKMP
LDQLASRVNANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVATGEVLAMASSPSYNPNSFSGTAKDAMRNRSIT
DVFEPGSTVKPMVVMTALQRGIVNENTVLNTIPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASNPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKSEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcaaaaacgctaaaaccaaaacgccaggaagaacaggccaactttgtc
agttggcgttttgcgttgctttgcggctgcattttactggcgctgggtttcctgctggga
cgcgtggcgtggctacaaatcatcgcgcctgacatgctggtgcgccagggtgatatgcgt
tctctgcgcgtgcaggaagtttctacctctcgtgggatgatcaccgaccgctccggccgc
ccgctggcggtgagcgtgccggtgaaggcgatctgggccgatccgaaagagctgcacgac
gcaggcgggatcacccttgataaccgctggaaggcgctctcagacgcgttgaaaatgccg
ctggatcagctggcgtcacgcgttaacgccaacccgaaagggcgcttcatctatcttgct
cgtcaggtgaaccctgacatggctgactacattaagaaactgaagctgccgggcattcat
ctgcgggaagaatcccgccgttactatccttccggcgaagtcaccgcgcacctgattggc
tttaccaacgtggatagccaggggattgagggcgttgaaaaaagcttcgacaagtggctt
accggccagcctggcgagcgaatcgtgcgtaaagaccgctatggtcgcgtcattgaagac
atttcctcgacagacagccaggccgcgcacaacctggccctgagtattgatgaacgcttg
caggcgctggtctatcgtgagctgaacaacgccgtcgcgtttaacaaggcggaatcgggc
agcgccgtgctggtggatgtggcgacaggtgaagtgctggcgatggccagtagcccctca
tacaacccgaatagtttttccggtacagcaaaagatgcaatgcgtaaccgctccatcacc
gatgtgtttgaacccggttcgaccgtaaaacccatggtggtgatgacggctctacagcga
ggcatcgtcaacgaaaataccgttctgaatacgatcccttatcgaattaacggtcacgaa
atcaaagacgtggcacgttacagcgaactgaccctgaccggggtcttacagaagtcgagt
aacgtcggtgtgtcaaaactggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttgggctgggaaaggcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacggg
ctaatggtaactcccttacagttagcgcgagtctacgcaacgattggcagctatggcatt
tatcgtccgctgtcgatcaccaaagttgatccaccggttccgggggaacgtgttttcccg
gaatctatcgttcgtaccgtcgtgcatatgatggaaagcgtcgcgttacctggcggtggc
ggcgtgaaggccgcaattaagggctatcgtatcgccattaaaaccggtacagcgaaaaaa
gtggggccggacggccgctatatcaacaaatacattgcctataccgcaggcgtagcgcct
gcaagcaatccgcgttttgcactggtggtcgtcatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtctccgcgcctgtgttcggggctattatgggcggcgtgttgcgcacc
atgaacattgaaccggatgcgctggcgacgggcgaaaaaagtgaatttgtaattaatcaa
ggcgagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system