KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_14125Help
Entry
BFV63_14125       CDS       T04821                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00550  Peptidoglycan biosynthesis
exf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BFV63_14125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:exf01002]
    BFV63_14125
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:exf01011]
    BFV63_14125
Enzymes [BR:exf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BFV63_14125
Peptidases and inhibitors [BR:exf01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BFV63_14125
Peptidoglycan biosynthesis and degradation proteins [BR:exf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BFV63_14125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CDPS
Motif
Other DBs
NCBI-ProteinID: AOP91969
LinkDB All DBs
Position
complement(2935424..2936590)
Genome map
AA seq 388 aa AA seqDB search
MKRRLFIAVSLLASSISSALAAEPLDFSPQPPAIQAGSWVLMDYTTGQILTAGNEHQQRN
PASLTKLMTGYVVDRAIDSHRISPDDIVTVGRDAWAKGNPVFDGSSLMFLKEGDRVSVRD
LSRGLIVDSGNDACVALADHVAGGQPQFVRMMNDYVEKLNLRDTHFETVHGLDAPGQHSS
AYDLAVLSRAIIHGEPEFYHMYSEKSLTWNGITQQNRNGLLWDKTMNVDGLKTGHTSGAG
FNLIASAVDGQRRLIAVVMGADSPKGREDQARKLLHWGQQNFDTVQILHNDKKVGTERIW
YGDKEQIALGTDQDFWLALPKSEVPNIKAKYVMDKKELEAPIAAHQRVGEIQLYDRDKVV
AHWPLVTLESVEKGGLFSRLGDYLHHKL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgccgtctgtttattgctgtttctttactcgcttcgagtatttcatccgcgctg
gctgccgagccgctggatttttcacctcagccgcctgccatccaggctggctcctgggta
ttgatggattacaccacgggtcaaatcttaacggcgggcaacgaacatcagcagcgcaat
ccggcgagcctgaccaaactgatgacggggtacgttgtcgatcgcgccattgatagccac
cgcatcagccccgatgacattgtgacggtcggacgtgacgcctgggcaaaaggcaatccg
gtctttgacggttcgtcgttgatgtttctgaaggagggcgatcgggtttccgtgcgcgat
ctcagccgcggcctgattgttgattccggcaatgatgcctgcgtggcgctggcggatcac
gtggcgggcggtcagccgcagttcgtcaggatgatgaatgactatgttgaaaagctgaac
ctgcgcgatacccacttcgaaaccgtacacgggctggatgcaccgggtcagcacagctcc
gcctacgatctcgccgtgctttcacgggccatcattcacggcgagcctgagttctaccac
atgtacagcgagaagagcctgacctggaacggcatcacccagcagaaccgcaacggcctg
ctgtgggataagaccatgaacgtggatggtctgaaaacgggacacacctcgggcgcgggc
tttaacctgattgcctcagcggtggacggtcagcgtcgactgattgcggtggtgatgggg
gcagacagcccgaaaggacgtgaagatcaggcgcgcaagctgctgcactggggacagcaa
aattttgatacggtgcagatcctgcataacgataaaaaagtgggaaccgagcgcatctgg
tacggtgataaagagcagatcgcgctgggcacggatcaggacttctggctggcattaccc
aaatcggaagtgccgaacatcaaggcgaaatacgtgatggataaaaaagagctggaagcg
ccgatcgccgcgcatcagcgggtaggggagatccagctgtacgatcgtgacaaggtggtc
gcgcactggccattggttacgctggaaagcgttgaaaagggtgggcttttctcccgtctt
ggcgattatctgcatcataaactctga

DBGET integrated database retrieval system