KEGG   Exiguobacterium sp. MH3: U719_13160Help
Entry
U719_13160        CDS       T02903                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
exm  Exiguobacterium sp. MH3
Pathway
exm00010  Glycolysis / Gluconeogenesis
exm00051  Fructose and mannose metabolism
exm00562  Inositol phosphate metabolism
exm01100  Metabolic pathways
exm01110  Biosynthesis of secondary metabolites
exm01120  Microbial metabolism in diverse environments
exm01130  Biosynthesis of antibiotics
exm01200  Carbon metabolism
exm01230  Biosynthesis of amino acids
Module
exm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
exm_M00002  Glycolysis, core module involving three-carbon compounds
exm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:exm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U719_13160 (tpiA)
   00051 Fructose and mannose metabolism
    U719_13160 (tpiA)
   00562 Inositol phosphate metabolism
    U719_13160 (tpiA)
Enzymes [BR:exm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     U719_13160 (tpiA)
Exosome [BR:exm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   U719_13160 (tpiA)
  Exosomal proteins of bladder cancer cells
   U719_13160 (tpiA)
  Exosomal proteins of melanoma cells
   U719_13160 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 17606959
NCBI-ProteinID: AHA30593
LinkDB All DBs
Position
complement(2445409..2446161)
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMNLTLKDAVAFVEEVKGAVPASTTVDAAVCAPAVFLAHLTEAAAGTDLK
IGAQNMYDKESGAFTGEISPLMLKELDVTYVILGHSERREYFGETDAFINSKAKKAFEHG
LVPIVCVGETLEEREGGKFEDVIREQTANSLKGLTVDQVKNLVVAYEPVWAIGTGKSATE
QDAQDSCKFVRDVVAAEFGAEAAEAVRIQYGGSVKPENIKEYMAQPDIDGALVGGASLET
GSFLKLLEAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaagatgaatctgacgctcaaggatgcagtc
gcattcgttgaggaagtcaaaggagctgtacctgcttcgacgacagtcgacgcagccgtc
tgtgcgccagcagtattcttggcacacttgacagaagcagcagctggtacggatcttaag
atcggtgctcaaaacatgtacgacaaagagagcggtgcgttcactggtgaaatcagcccg
ctcatgctcaaagaactcgacgtgacttacgtcatcctcggtcactctgagcgtcgtgag
tacttcggcgaaacagatgcgttcatcaacagcaaagcgaaaaaagcgttcgagcacggc
ctcgttccaatcgtttgtgtaggtgaaacactggaagagcgtgaaggcggcaagttcgaa
gacgtcatccgcgaacagacagcaaacagcctcaaaggtcttactgtcgaccaagtgaaa
aatctcgtcgtcgcttacgagcctgtctgggcaatcggaacaggtaaatcagcgacagaa
caagatgcacaagattcttgtaaattcgtccgcgacgtcgttgcagctgaattcggtgct
gaagcagcagaagctgtccgcatccaatacggtggtagcgtcaaaccggaaaacatcaaa
gaatatatggctcaaccagacatcgacggcgcgctcgtcggcggtgcaagtcttgagaca
ggatcgttcctcaaactgttggaggcgatttaa

DBGET integrated database retrieval system