KEGG   Exiguobacterium sp. MH3: U719_16005Help
Entry
U719_16005        CDS       T02903                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
exm  Exiguobacterium sp. MH3
Brite
KEGG Orthology (KO) [BR:exm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:exm01002]
    U719_16005
Enzymes [BR:exm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     U719_16005
Peptidases [BR:exm01002]
 Metallo Peptidases
  Family M4: thermolysin family
   U719_16005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 PepSY FTP Bacillus_PapR
Motif
Other DBs
NCBI-GeneID: 17607527
NCBI-ProteinID: AHA31078
LinkDB All DBs
Position
3017336..3018832
Genome map
AA seq 498 aa AA seqDB search
MKKFLATSLVASVLVVPTVVGAEGLQSGKLTKASSEPAATIVKDFVNKKGDFAVQNVEKD
GSSQIVRLQQEVDGVPVFGSVVVGNVAKDGTLKAVVNDAINVKGKPGLAKKATLSEKKAI
KLYQKAIKASKFEVAPKAELVIYPVKDDAVYAYKVTSTVLAGKEPSRWTYFIDANSGKVL
NKFDQLAHATGTTVLGTSATFNTTLSGSTYYLQDTTRGKGVYTYDAKNRTSLPGTLWADA
DNVFNATYDRAAVSAHVNAAKTYDFYKNTYGRNSYDNAGARLNSTVHYSTNYNNAFWDGT
KMVYGDGDGTTFVALSGALDVVAHELTHAVTEYTAGLVYQNESGAINEAVSDIMGTVAEY
TVGSNFDWLVGEDIYTPGVSGDALRSMSNPAAYGDPDHYSKRYTGTQDNGGVHINSGIIN
KAAYLLGNGGTFYNVSVTGIGVPKLGAIYYRALNTYLTPNSNFSSLRAAVIQSAKDLYGS
TSAEATAAAKSFDAVGVY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagtttctcgctacatcgcttgtcgcaagtgtacttgttgttcctacagtcgta
ggtgcagaaggtcttcagtctggtaaactcacgaaagcttcgtcagaaccagctgcaacg
atcgttaaagatttcgtgaacaaaaaaggtgactttgctgttcagaacgtcgaaaaagac
ggatcttcacagatcgtacgtctccaacaagaagtggatggcgtccctgtctttggtagt
gtcgtcgtcgggaacgtcgcgaaagacggtactttgaaagcagtcgtaaacgatgcgatc
aacgttaaaggaaaaccaggtctcgcgaaaaaagcaacgctctctgaaaagaaagcgatc
aagctttatcaaaaagcaatcaaggcttctaaattcgaagtcgctccaaaagcagaactc
gtcatctatccagtaaaagatgatgctgtgtatgcatacaaagtcacatcgactgtcctc
gcgggcaaagagccatcacgttggacatacttcatcgatgcgaactcaggtaaagtactt
aacaagtttgaccaactcgctcacgcaacaggtacgacagtacttggtacaagcgcaaca
ttcaatacgacgttgagcggttcaacgtactatcttcaagatacgacgcgtggtaaaggt
gtctacacatacgacgcgaaaaaccggacatcactcccaggaacactctgggcagatgca
gataacgtctttaacgcgacatatgaccgcgctgctgtcagtgcacacgtcaacgctgca
aaaacatatgatttctataaaaacacatatggtcgtaacagttacgacaacgctggtgca
cgcttgaactcaacagttcactattcaacgaactacaacaacgcattctgggatggcacg
aagatggtctatggtgacggagatggcacgacattcgtcgcactctcgggcgcacttgac
gtcgtcgctcacgaattgacacacgctgtcacagaatacacagctggtctcgtgtaccaa
aacgaatctggtgcgatcaacgaagccgtttcagatatcatgggtacagtagctgagtat
acagtcggatcgaacttcgactggctcgtaggagaagacatctacacacctggagttagc
ggtgacgcactccgttcgatgtcgaacccagctgcttacggcgatcctgatcactactca
aaacgttacacaggtacacaagataacggtggtgtccatatcaactctggtatcatcaac
aaagctgcttacctcctcggtaacggtggaacgttctacaacgtatctgtcacaggaatc
ggtgtaccgaaactcggtgcgatctactaccgtgccctcaacacgtacttgactccgaac
tcgaacttcagctcactccgtgcagcagtcattcaatcggcaaaagacctttacggttca
acaagtgcggaagcaacagctgcagcgaaatcatttgatgcagtaggcgtctactaa

DBGET integrated database retrieval system