KEGG   Exiguobacterium sp. MH3: U719_16305Help
Entry
U719_16305        CDS       T02903                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
exm  Exiguobacterium sp. MH3
Brite
KEGG Orthology (KO) [BR:exm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U719_16305
Enzymes [BR:exm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     U719_16305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 Thi4 NAD_binding_7 K_oxygenase Glutaredoxin Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-GeneID: 17607587
NCBI-ProteinID: AHA31134
LinkDB All DBs
Position
3079940..3081469
Genome map
AA seq 509 aa AA seqDB search
MALAPDIKAQLAQYLELLEGDLVLAVSAGTDAVSLEMSALVEEIASMTPRISVEQASLPR
TPSFTVNRVGETSGITFAGIPLGHEFTSLVLALLQVSGRAPKVDADVIKQIQGIQETYHF
ESYISLSCHNCPDVVQALNVMSVLNPNISHTMIDGAAFKAEVEQKEIMAVPTVFVNGEAF
GNGRMSLEEILAKLGTGADASDFADKDPYDVLVVGGGPAGSSAAIYAARKGIRTGIVAER
FGGQVMDTMSIENFISMKYTEGPKLVASLEEHVKEYGIDVMNLQRATRLEKKDLLELELE
NGAVLKTKSLILSTGARWRNVGVPGELEFKNKGVAYCPHCDGPLFEGKRVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFAPELKADAVLQERLASLPNVTVVVNAQTKEITGTDKVNGITY
IERETNVERHVELEGVFVQIGLVPNTDWLGETVNRNKFGEVQVDRHGATNVPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDHLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggctttagcaccagacattaaagcacaactcgcgcaatacctcgagcttctcgaaggc
gatctcgtcctagccgttagtgctgggacagacgccgtctcgcttgagatgagcgcactc
gtcgaagagatcgcaagcatgacaccacgcatctccgtcgagcaggcaagtcttccccgg
acaccaagtttcacagtcaaccgtgtcggtgaaacaagcggcattacgttcgcgggaatc
ccactcggtcatgagttcacgtccctcgttctcgctctgctccaagtcagcggtcgagca
ccgaaggtcgatgcggacgtcatcaagcagattcaaggcattcaagaaacgtaccacttc
gagtcgtacatcagcttgagctgccacaactgcccggatgtcgtacaagcattgaacgtc
atgagcgtcctcaacccgaacatcagtcacacgatgattgatggcgcggcatttaaagca
gaagtcgaacaaaaagagatcatggctgttccgacggtcttcgtcaacggcgaagcgttc
ggtaacggacggatgtcgcttgaagaaatcttggcgaagcttggtacaggtgccgatgct
tctgatttcgctgataaagatccatacgatgtcctcgtcgtcggtggtggtccagctgga
tcgagtgctgccatctatgcagcccgtaaaggcatccggacaggaatcgtcgcagaacgc
ttcggtggacaagtcatggatacgatgagcatcgagaacttcatcagcatgaagtacacg
gaaggaccaaaactcgtcgcaagtcttgaggagcacgtcaaggaatatggcatcgacgtc
atgaacctacaacgggcaactcgccttgagaagaaggacctccttgagctcgagcttgag
aatggtgctgtcttgaaaacgaagagtttgatcctttcaacaggtgcacgctggcgtaac
gttggtgtcccaggcgaactcgaattcaagaacaaaggcgtcgcctactgcccacactgt
gatggtccgttgttcgaaggaaaacgtgtcgcagtcatcggtggcggaaactcaggaatc
gaagcagccatcgatctcgcaggaatcgtcaagcatgtcacagtccttgagttcgcaccg
gaattaaaagcagacgctgttcttcaagaacgcctcgcttcacttccgaacgtcacggtc
gtcgtcaacgcacagacgaaggaaatcacaggaacggacaaagtgaacggtatcacgtac
atcgagcgcgaaacgaacgtcgaacgtcacgttgagctcgagggtgtcttcgtccagatc
ggtctcgtaccgaacacagactggctcggtgaaacggtgaaccgtaacaagttcggtgaa
gtccaagtcgatcgccacggcgcaacgaacgtaccaggcgtttttgctgcaggagactgc
acagatagcgcgtataaacagatcatcatctcgatgggatctggtgcaacagctgcactc
ggtgctttcgatcacttgatccggaattaa

DBGET integrated database retrieval system