KEGG   Exiguobacterium sp. U13-1: ESP131_01445Help
Entry
ESP131_01445      CDS       T04561                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00330  Arginine and proline metabolism
exu01100  Metabolic pathways
exu01110  Biosynthesis of secondary metabolites
exu01130  Biosynthesis of antibiotics
exu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ESP131_01445
Enzymes [BR:exu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     ESP131_01445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH Inhibitor_I9
Motif
Other DBs
NCBI-ProteinID: AOS99034
LinkDB All DBs
Position
complement(274096..274866)
Genome map
AA seq 256 aa AA seqDB search
MKLLVVGAGAMSEALVQGWVASGFAREDITMTNRSGGARLTEVAARHGVQTVEQEDVSLY
DIVMLGMQPDGVLDYIANQEWTNQTIVSIAAHITPHEIERLAKRPTVAAMPNTPVAHCLG
MTGLWFGSRVNEEIRSVVEALFGRVGEIAEANESTMPAFMAAAGCSPAFFYEIVAGMVPV
LTDTGFEEENARRIVAQAMKGSAEILMRSDASTDRLIANVAAPGGPTDRGVQVLRERQLF
DTMQAALRESARETEE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttagtagtaggagccggtgcgatgagtgaggcactcgttcaagggtgggtc
gcttctggatttgcacgagaagatatcacgatgacgaatcggagtggcggggcacgtttg
acagaagtcgcagcgcgacatggtgttcagacggtcgagcaggaggacgtctccttatac
gatatcgtcatgctgggcatgcaacccgatggtgtactcgactatatagcgaatcaagaa
tggacgaatcagactattgtttcgattgccgcacacattacaccacatgaaatcgaacgg
ttggcaaaacgtccgacagtcgctgccatgccgaatactcccgtcgcacattgtttagga
atgactggactatggttcggctcacgcgtgaatgaagagatccgaagtgtagtcgaggca
ttatttggacgcgtcggagaaattgcggaagcaaatgaatcgacgatgcctgcattcatg
gcggcagctggatgtagtcctgctttcttctatgaaatcgtagctggcatggtgccggtt
ttgacggatactggttttgaagaagaaaatgcacgtcgaatcgttgctcaagcgatgaaa
ggttcagccgaaattctcatgcgctccgacgcaagtacggatcgtcttattgccaatgtt
gcggcacctggtggaccaacggatcgtggcgtccaagtgctacgcgagcgtcagctgttc
gatacgatgcaagcggcactgcgagagagtgcacgcgaaacagaagaataa

DBGET integrated database retrieval system