KEGG   Exiguobacterium sp. U13-1: ESP131_06900Help
Entry
ESP131_06900      CDS       T04561                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00500  Starch and sucrose metabolism
exu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ESP131_06900
Enzymes [BR:exu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ESP131_06900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 GATase_7
Motif
Other DBs
NCBI-ProteinID: AOT00001
LinkDB All DBs
Position
1365856..1367316
Genome map
AA seq 486 aa AA seqDB search
MERNHTMMQFFEWHVENDGKHWQRLKERAPELRAAGITSVWIPPASKGQSDEDTGYGIYD
VYDLGEFDQKGTVRTKYGTKDELVEAIQVARENDIAIYADVVMNHKAAADELETINVVEV
HPEDRSKEISEEFEIEAWTKFTFPGRNGKYSDFVWTHEFFNGTDFDAREEKTGVFKISGK
NKDWNDQVDDEFGNYDYLMFANIDYNHPEVREEMIRWGHWFQETIDCQGFRLDAIKHINY
EFVHEFAKSMIEKNDGDFYMVGEFWKSDLDDCRHFLDSVDYTIDLFDVPLHYKFHEASNQ
GQEFDLTTLFTDTLVESHPTNAVTFVDNHDSQPGESLESWVDDWFKQHAYASILLRKDGY
PCVFYGDYYGVQGPHPVEGKKEMIDALLYARYHKAYGDQEDYLDDPHCVGWVRRGVEEIE
NSGCAVLLSNADMCEKRMFVGEERAGQEWFDYTNHQDHPVVIDDEGFGVFPVPGGGVSVF
APREVE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaaccatacgatgatgcagttttttgagtggcatgtagagaatgatgggaag
cactggcaacgcttgaaagagcgggcgcctgaattacgtgctgccggcatcacgtccgtg
tggattccaccggcgtcaaaaggtcaatcagatgaagatacaggatatggaatttatgac
gtatatgatttaggcgaatttgatcaaaaaggaacggtccgtacgaaatacggtacaaag
gatgaactcgtcgaagcgattcaagtcgctcgtgagaatgacatcgccatttatgcggat
gttgtcatgaaccataaagcagcagccgatgaacttgagacaatcaatgtcgttgaggtc
catccagaagaccgttcgaaagaaatttcagaagaattcgaaatcgaagcatggacgaaa
tttacgttccctggtcgaaacggaaaatattcggattttgtctggacacatgaattcttt
aatggaacggatttcgatgctcgtgaagaaaaaaccggtgtcttcaagatatccggtaaa
aataaagactggaacgatcaagtcgatgacgaattcggaaactatgattatttgatgttc
gcgaacatcgattataaccatccggaagtacgtgaagagatgatccgctgggggcattgg
ttccaagagacgattgactgccaaggattccgactcgacgcaatcaaacatatcaattat
gaattcgttcatgaatttgcaaaatcgatgatcgagaaaaatgatggcgatttctatatg
gtcggggagttctggaaatcagatctcgatgattgccgtcatttccttgatagcgttgat
tacacgatcgatttgttcgacgttccccttcattataaattccatgaagcttcgaaccag
ggacaagagtttgatttaacaacgttgtttacagatacgctcgtcgaatcacacccgacg
aatgctgtcacgttcgtcgataatcatgattcacaaccaggtgaatcactcgaatcatgg
gtagatgactggttcaaacagcatgcgtatgcatcgatcttacttcgtaaagacggttat
ccatgtgtcttctacggtgactattatggagtgcaaggacctcatcctgtagagggtaaa
aaagaaatgattgatgctttactgtatgcacgttatcacaaagcatatggtgaccaagaa
gattatctcgatgatccgcattgcgtcggttgggttcgtcgaggcgtagaagaaatcgag
aactctggctgtgctgtcttattgtcgaatgctgacatgtgcgagaagcgcatgttcgtt
ggtgaagagcgcgcgggacaagagtggttcgattatacgaaccaccaagatcacccagtt
gtgatcgacgatgaaggattcggtgtcttcccagttccaggtggaggtgtctctgttttt
gctccacgagaagtcgagtaa

DBGET integrated database retrieval system