KEGG   Exiguobacterium sp. U13-1: ESP131_07775Help
Entry
ESP131_07775      CDS       T04561                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00260  Glycine, serine and threonine metabolism
exu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ESP131_07775
Enzymes [BR:exu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     ESP131_07775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Methyltransf_25 MTS Methyltransf_11 Met_10 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AOT00162
LinkDB All DBs
Position
1532660..1533748
Genome map
AA seq 362 aa AA seqDB search
MTKLVTTVEETATTKTMRALVKEERGVGATLKEVPVPVPSRGEVLIRVEATSICGTDVHI
YEWDAWAASRVNPPYVFGHEFSGEVVELGEGTKRLKLGDRVSAETHIVCHQCKQCLRGQY
HICKNTKIIGVDTQGCFAEYVVMPEENLWVNPEDMPAGIASIQEPMGNAVHTVLASDVSA
KTVAIVGCGPIGLMAVSVAKAAGAAEVVAIDVNPYRLELARTMGADVVIDSRHDDVLERI
ERMTDGDGIDVVCEMSGHPVAIRQAFEMVTAGGDVNILSLPVKPVEIDLTNHVVFKGVRV
QGITGRKMYETWSQVSAFLSSGKVDVRPLITHTLPLERFEEGFELMRQGKCGKVVLQPRG
TN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaattagtaacgacggtagaagagacagcaacgacaaaaacgatgcgcgcgctt
gtcaaagaagagcgcggagttggtgcgacactgaaagaagtaccggtacccgtaccgagt
cgtggagaagtcttgattcgagtcgaggcaacatcaatctgtgggacggacgtgcatatc
tatgagtgggacgcgtgggcagcttcacgtgtcaatccgccgtatgtcttcggtcatgag
ttctcgggcgaagtcgtcgagctcggagaaggcacgaaacgcttgaaactcggtgaccgt
gtctcggctgagacgcatatcgtctgtcatcaatgtaaacagtgtctacgtgggcaatac
catatctgtaagaacacgaagatcatcggtgtcgatacacaaggttgttttgcggaatac
gtcgtcatgccggaagaaaacctctgggtcaacccggaagacatgccagcagggattgcc
tcgatccaagagccaatgggaaatgccgtccataccgttcttgcgagtgatgtcagtgcg
aaaacggtcgcaatcgtcggttgtggtccaattggtctgatggcggtctcggtcgctaaa
gcagccggtgcggcggaagtcgttgcgatcgacgtcaatccgtatcgtctcgaactcgcg
cggacgatgggggcggatgtcgtcatcgattcacgtcatgacgatgtcttagagcgaatt
gaacgtatgacggacggcgacgggattgatgtcgtctgtgagatgagtggtcatcctgtt
gcgattcgtcaagcgttcgagatggtgacagcaggtggagacgtcaacattcttagtctg
ccggtcaaaccggtcgaaatcgatttgacgaaccacgtcgtcttcaaaggcgtccgggtt
caaggcatcaccggtcggaagatgtatgagacatggagtcaagtttctgctttcttgtcg
agcggaaaagttgatgtccgcccgttgatcacacacacattgccgcttgagcggttcgaa
gaaggatttgaattgatgcgtcaagggaaatgcggaaaagtcgtattacaaccaaggggg
acgaattaa

DBGET integrated database retrieval system