KEGG   Exiguobacterium sp. U13-1: ESP131_12390Help
Entry
ESP131_12390      CDS       T04561                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00473  D-Alanine metabolism
exu00550  Peptidoglycan biosynthesis
exu01100  Metabolic pathways
exu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:exu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ESP131_12390
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ESP131_12390
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ESP131_12390
Enzymes [BR:exu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ESP131_12390
Peptidoglycan biosynthesis and degradation proteins [BR:exu01011]
 Precursor biosynthesis
  Amino acid ligase
   ESP131_12390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK ATPgrasp_ST GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AOT01016
LinkDB All DBs
Position
complement(2367413..2368357)
Genome map
AA seq 314 aa AA seqDB search
MKVAVLYGGTSGEREVSLNSGKSIMEALNSKGHEVTAVDFHPDQAHELFQLDVDVAVIAL
HGKIGEDGRVQALLELADIPYTGSGVLASALAMDKARSKVHFDKAGITIARDVLLERGDD
IEAKIAEWNGQFPCVVKPAQEGSSNGLTIAQDETMLREGIAKAFEADDAVLVEQFIKGRE
VTVPVVGHKGAEKALPVIEIIPKNAFYDYESKYAIGGSEHICPAELDEATTEKLQEWAVK
AHQVLGCAGYSRSDFLVPESGNPVILETNTLPGMTSTSLFPDGARAVGIEYPELVEYFME
LAIERHRQTKQPNQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggcagtattatacggtgggacttcaggagaacgggaggtttcattaaacagt
ggaaagtcgatcatggaagcattaaacagtaaagggcatgaggtcacggctgttgatttc
caccctgatcaagcgcatgaactcttccagctggatgtagatgtggctgtcatcgctctt
cacgggaaaattggtgaagatggacgcgtacaagcattgcttgaactggcagacattcca
tatacaggttcaggtgtgttagcgtcagcgctagcgatggataaggcacgttcgaaagtt
cactttgataaagcaggcattacgatcgctcgtgatgtgctgttagagcgtggagatgat
atcgaagcaaaaatcgcagagtggaatggtcaatttccttgtgtcgtcaaaccagcacaa
gaaggctcatcaaacggattgacgattgctcaagacgagacgatgttacgtgaaggaatc
gcgaaagcctttgaagcagacgatgcagttcttgtcgaacagtttattaaagggcgtgaa
gtgacagttccagtcgtcggacataaaggtgcagaaaaagcactgccggtcatcgagatc
attccgaagaacgctttttatgactatgaatccaaatatgccatcggaggttcggagcat
atttgtcctgctgaactggatgaagcaacgacagaaaaacttcaagaatgggctgttaaa
gcgcatcaagtacttggctgtgcaggatactcgcgatctgatttccttgtgccggaatcc
ggaaatccagtcatcttggagacgaatacacttcctggtatgacttcgaccagtttattc
ccggacggtgcacgagcagtgggaattgaatatccggaattggtcgaatatttcatggaa
ctggcgatcgaacgacatcgtcaaacaaaacaaccaaatcaatga

DBGET integrated database retrieval system