KEGG   Exiguobacterium sp. U13-1: ESP131_12945Help
Entry
ESP131_12945      CDS       T04561                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
exu  Exiguobacterium sp. U13-1
Brite
KEGG Orthology (KO) [BR:exu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:exu01001]
    ESP131_12945
Enzymes [BR:exu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ESP131_12945
Protein kinases [BR:exu01001]
 Serine/threonine kinases: Other
  Bacterial family
   ESP131_12945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH RIO1 Kdo Kinase-like DUF4366 FTA2
Motif
Other DBs
NCBI-ProteinID: AOT01124
LinkDB All DBs
Position
complement(2474803..2476737)
Genome map
AA seq 644 aa AA seqDB search
MRYGDRLNDRYRIERLVGSGGMANVYQAYDEILKRHVAIKILRTEFSHDEQFIRRFEREA
HAATSLNHPNIVAVYDVGEEDAIYYIVMEYIDGMTLKTFCENQALPVPQAVDIIAQICDA
IDHAHAHRIIHRDIKPQNMLIREDGTVKVTDFGIAVAMSNATLTHTMSVLGSVHYFSPEQ
AKGKFADEKSDIYSLGAVLYELVTGQVPFEGDSPVAIALKHLQDTPRRPSVLNPKVPQAL
ENCIMQALAKAPHDRQQSVAAFKADMVTALSDERASEGIRGAEEDEMEKTMVLSPVQVPE
ESKAEPESPAVTTVQPKTPEKKKKKRWWIVLLLLVLLGGAATTFAMWPDPTVTVPSVVKT
DGDDAETKLEKLGFVVETTERNSDTVDEGDVISQTPRENAQVKKGSTVNLVVSTGSAPVE
VPDVTDDAEKEAIATLKEAGFAKVEVEREKSDEIARGNVIRQSISAGTEVIAKEQTITIT
VSEGTSSFELKDLTNLSSDEAKAYLDEMGLDGTFEQEFSSDVKLDQVIRQFPQAGAQVEP
NDSVTVFISKGEEEKTVTATFPEKVVYDAVSENEDEEPPKQVIRIETEDAKGKRTVIEES
IDQDETFDVPVTIDPGEEGKITIYKDDTVYRSKTITYNQAKDAQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacggagatcgattaaatgaccgctaccgcatagaacggctagttggaagtggc
gggatggcgaatgtctatcaagcctatgatgagattttaaagcgtcatgttgccattaag
attttacgaactgaattttcgcatgacgaacaattcattcgtcgattcgaacgtgaagca
catgctgctaccagcttgaatcatccaaacatcgttgccgtctatgatgtaggcgaagaa
gatgccatctattacatcgtcatggagtatatcgatggtatgacattaaaaacattttgt
gaaaatcaagcattacctgtgccgcaggcagttgatatcatcgctcaaatttgtgatgca
atcgatcacgcccatgcacaccggattatccatcgcgatattaaaccgcaaaacatgttg
attcgagaagatggtaccgtcaaagtaacggatttcggaattgctgtggcgatgtcgaat
gcgacgctgacgcatacgatgtccgttcttgggtccgtgcattacttttcaccggaacaa
gcaaaaggtaaatttgcggatgagaagtcggatatctattcacttggtgctgtcttatac
gaacttgttacaggacaagtgccgttcgaaggggattcaccggtcgcgattgcgctgaag
catctgcaagatacaccgcgtcgcccatccgtcttgaatccgaaagtgccacaagcgctt
gagaactgtatcatgcaggcgctcgcgaaagcaccgcatgaccgccaacagtccgtcgca
gcctttaaggcagatatggtgacggcgttgtctgacgaacgggcaagtgaaggcattcga
ggtgcagaagaggatgagatggaaaagacgatggtcttgtcacccgtccaagtgccagaa
gaatcaaaagcggaaccagaatcacccgccgtcacgactgttcaaccgaaaacaccggaa
aagaaaaagaaaaaacgctggtggatcgttctcttattgctcgttttactcggtggagcg
gctacgacgtttgcgatgtggccggatccaacggtcaccgtaccatctgtcgtcaagaca
gatggagacgatgcggaaacgaagcttgagaaacttggattcgtcgtcgagacgacagaa
cgaaatagcgatacagtcgatgaaggcgatgtcattagtcagacaccgcgtgaaaatgca
caagtcaaaaagggttcgacggtcaacttggtcgtctctacaggtagtgctccggtcgaa
gtaccagatgtgacagatgacgctgaaaaagaggcgattgcaacattaaaagaggctgga
ttcgcaaaagtcgaggtcgaacgtgaaaagtcggatgaaattgcgcgaggtaatgttatc
cggcaatcgatctctgctggaacggaagtgattgcaaaagaacagacgattacgatcact
gtctcggaaggaacgtcatcctttgaattgaaagacttgacgaacttatcgagtgatgaa
gcgaaagcgtatctcgatgaaatgggtctcgacggtacgtttgaacaagaattctcgagt
gatgtcaagctcgatcaagtcatccgtcaattcccacaagcaggggcacaagtcgaacca
aacgactctgtgaccgtcttcatctcaaaaggtgaggaagaaaaaacggtgacggcaacg
ttccctgaaaaggtcgtctatgatgcggtcagcgagaacgaggacgaggaaccaccgaaa
caagtcatacggattgagacggaagacgcgaaagggaagcggaccgtcatcgaggaatcg
attgatcaagatgagacattcgacgtgccggtgacgattgatccaggagaagaaggaaaa
attacgatctataaagacgatacggtgtatcgttcaaaaaccatcacgtacaatcaagca
aaagacgcacaatga

DBGET integrated database retrieval system