KEGG   Exiguobacterium sp. U13-1: ESP131_13525Help
Entry
ESP131_13525      CDS       T04561                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00061  Fatty acid biosynthesis
exu00780  Biotin metabolism
exu01100  Metabolic pathways
exu01130  Biosynthesis of antibiotics
exu01212  Fatty acid metabolism
Module
exu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ESP131_13525
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ESP131_13525
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ESP131_13525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:exu01004]
    ESP131_13525
Enzymes [BR:exu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ESP131_13525
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ESP131_13525
Lipid biosynthesis proteins [BR:exu01004]
 Fatty acid synthase
  Component type
   ESP131_13525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase WXG100
Motif
Other DBs
NCBI-ProteinID: AOT01234
LinkDB All DBs
Position
complement(2587135..2587908)
Genome map
AA seq 257 aa AA seqDB search
MNIYPSLEGKTYVVMGVINQRSIAWGIARALDAAGASLAFTYVGERFKAPLEKLGQELSR
PASYYTCDVTSDEEIEQVFQTIHADHGKISGIAHSIAFADKEALRGEFSGVTREQFAQAL
DISAYSLTAVVKAAKDFFTEDASVITLTYLGGEKMVPNYNVMGVAKAALDASVRYLAAEY
GQQSVRVNAISAGPIRTVSAKGVGDFNSILDSIEERAPLHRNVTTEQIGQSGLFLLSQMS
SGVTGEILHVDSGFHIL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttatccttcactcgaaggcaagacgtacgtcgtcatgggcgtcatcaaccaa
cgttcgattgcatggggtatcgcacgtgcgctcgacgctgctggagcaagcctggcattt
acatatgtcggggaacgttttaaagcaccacttgaaaaattagggcaagaattatcacgt
ccggcttcttattatacgtgtgatgtcacaagtgatgaagaaatcgaacaggtcttccaa
acaatccatgcggatcacggtaagatttcaggaatcgctcactcgatcgcattcgcggac
aaagaagcgcttcgtggtgaattctctggagtaacgcgtgaacagtttgcgcaagcactt
gatatctcagcctacagcttaacagcagtcgtcaaggcggcgaaggatttctttacggaa
gatgcatccgtcatcacgttgacgtaccttggtggtgagaagatggttccgaactacaac
gtcatgggtgttgcgaaagccgcattagatgcaagcgttcgttatctcgctgctgaatat
ggtcagcaaagcgttcgtgtcaatgccatctcagctggtccaattcggacagtatcagca
aaaggtgtcggcgacttcaattcgattcttgatagcatcgaagaacgtgcgccacttcat
cgtaacgtcacgacagaacaaattggtcaaagtggactgttcttgctttcacaaatgtcg
agtggggtgacaggagaaatccttcacgttgatagcggattccacattctttaa

DBGET integrated database retrieval system