KEGG   Exiguobacterium sp. U13-1: ESP131_14345Help
Entry
ESP131_14345      CDS       T04561                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00020  Citrate cycle (TCA cycle)
exu00480  Glutathione metabolism
exu01100  Metabolic pathways
exu01110  Biosynthesis of secondary metabolites
exu01120  Microbial metabolism in diverse environments
exu01130  Biosynthesis of antibiotics
exu01200  Carbon metabolism
exu01210  2-Oxocarboxylic acid metabolism
exu01230  Biosynthesis of amino acids
Module
exu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
exu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ESP131_14345
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ESP131_14345
Enzymes [BR:exu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ESP131_14345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOT01385
LinkDB All DBs
Position
complement(2763408..2764682)
Genome map
AA seq 424 aa AA seqDB search
MATLQGENITVTNGTLQVPNAPIIPFIIGDGTGPDIWNAAVRVFDAAVEKAYNGEKKIEW
KEVYAGEKAFNKTGNWLPEETLDLIREHIIAIKGPLTTPVGGGIRSLNVALRQELDLYTC
LRPVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAEGSEGAAKLLEFLQNEMGVNK
IRFPETSGLGIKPISKEGTERLVRAAIEYALENKRASLTLVHKGNIMKFTEGAFKNWGYE
LAEREYAEHVFTWNQYDRIKEEEGTDAANKAQADAEAAGKLIVKDSIADIFLQQILTRPK
EFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYMTGHAIFEATHGTAPKYAGLDKVN
PSSVILSGEMMFRHLGWNEAADLIIKSMETSIETKVVTYDFARLMDGATEVKCSEFADEL
IKNM
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctacacttcaaggcgaaaacatcacagtaactaacggtacacttcaagttccaaac
gctccaatcattccgttcatcattggtgacggaacaggacctgacatctggaacgcagct
gtacgtgtgtttgatgcagcagttgaaaaagcatacaacggtgagaagaaaatcgaatgg
aaagaagtctacgctggtgaaaaagcattcaacaaaacaggcaactggttaccagaagag
acactcgatctcatccgtgagcacatcatcgcaatcaaaggaccacttacgacaccagtc
ggcggcggaatccgttcgttgaacgttgctctacgtcaagagcttgatttgtacacatgt
cttcgtccagttcgttacttcacaggtgttccttcaccggttaaacgcccagaagataca
gacatggtcatcttccgtgaaaatactgaagacatctacgcaggaattgaatacgcagaa
ggcagcgaaggcgctgcaaaactgcttgagttccttcaaaacgaaatgggtgtcaataaa
atccgcttccctgagacatctggtcttggaatcaaaccgatttcaaaagagggaacagaa
cgccttgttcgtgcagcaatcgaatacgcacttgaaaacaaacgtgcttcattgacgctc
gttcataaaggaaacatcatgaagttcactgagggtgctttcaaaaactggggctatgaa
cttgctgagcgtgaatacgcagagcacgtcttcacttggaaccagtacgatcgcatcaag
gaagaagaaggaacagatgctgccaacaaagcacaagcagacgcagaagctgctggtaag
ttgatcgtaaaagattcaatcgctgatatcttcttacaacaaatcttgactcgtccaaaa
gagtttgatgtcgttgcaacaatgaacttgaacggtgactacatttcggatgcacttgct
gcacaagtcggtggtatcggaatcgcacctggagcaaacatcaactacatgacaggtcac
gcaatctttgaagcaactcacggtacagcaccgaaatacgctggacttgataaagtaaac
ccatcatctgtcatcttgtcaggcgaaatgatgttccgtcacctcggctggaacgaagcg
gcagatctcatcatcaaatcgatggaaacatcgattgaaacgaaagtcgtcacatacgac
ttcgcgcgtctcatggacggtgcgactgaagtgaagtgttctgaattcgcggacgaactc
atcaaaaacatgtaa

DBGET integrated database retrieval system