KEGG   Exiguobacterium sp. U13-1: ESP131_14910Help
Entry
ESP131_14910      CDS       T04561                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00627  Aminobenzoate degradation
exu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ESP131_14910
Enzymes [BR:exu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     ESP131_14910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: AOT01494
LinkDB All DBs
Position
complement(2881016..2881780)
Genome map
AA seq 254 aa AA seqDB search
MKAKGYLFDLDGTMYNGTEPVKEAVDFVNRLQAEGIPYLFVTNNASMTAEAVAEKLRGMG
VHSDAKHVLTSAMATGRYIADLSPKARVYAIGETGLIDALEREGLDVVATEAADYVVIGL
DRQITYEKLAVGALAIRAGARFISTNGDIAIPTERGFLPGNGALTSVLRVTTEKEPFFIG
KPEPVMVDIATEMIGLSKENVIMVGDNYHTDILFGINGGIRTMHVNSGVHTPVFIQGQDR
QPTYMVDTLAEWIL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaaaggctatttatttgatttagatggaacgatgtacaacggaacggaaccg
gtaaaagaagcggtcgatttcgtcaatcgtctgcaagcagaagggattccgtatttgttc
gtgacgaataatgcgtcgatgacggcagaagctgtcgcggagaaattacgcgggatgggt
gttcattctgatgcgaagcatgtcttgacgagtgcgatggcgactggtcgttatatcgct
gatctatcaccgaaagcgcgcgtctatgccatcggagaaacaggattgatcgatgcgctt
gaacgggaagggttagacgtcgtcgcaaccgaagcggcagactacgtcgtcatcggtctc
gaccgtcagatcacgtatgaaaaactcgctgtcggtgcccttgcgattcgtgctggtgct
cgtttcatctcgacgaatggtgacatcgcgattccgacagaacgtggtttcttaccaggt
aacggtgccttgacgtctgtcctgcgcgtgacaacggagaaggaaccgttcttcatcggt
aaaccggaaccggtcatggtcgatatcgcaacggagatgattggtctatcgaaagaaaac
gtcatcatggtcggggataactaccatacggatattctgttcggaatcaatggaggcatc
cggacgatgcacgtcaattctggcgtccatacacccgtcttcattcaaggtcaggatcgt
caaccgacatatatggtcgatacgttagctgaatggattctgtga

DBGET integrated database retrieval system