KEGG   Eggerthella sp. YY7918: EGYY_01770Help
Entry
EGYY_01770        CDS       T01566                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eyy  Eggerthella sp. YY7918
Pathway
eyy00250  Alanine, aspartate and glutamate metabolism
eyy00410  beta-Alanine metabolism
eyy00430  Taurine and hypotaurine metabolism
eyy00650  Butanoate metabolism
eyy01100  Metabolic pathways
eyy01110  Biosynthesis of secondary metabolites
eyy01120  Microbial metabolism in diverse environments
eyy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eyy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EGYY_01770
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EGYY_01770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EGYY_01770
   00430 Taurine and hypotaurine metabolism
    EGYY_01770
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EGYY_01770
Enzymes [BR:eyy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EGYY_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Acetyltransf_14
Motif
Other DBs
NCBI-ProteinID: BAK43421
UniProt: F7UXG3
LinkDB All DBs
Position
179185..180672
Genome map
AA seq 495 aa AA seqDB search
MEQSATSKVLDSMDEGTKYLTPIFGSESSDAQMPRLTMNDQPVEPRIAYEMIKEYLSIEG
NATQNLTTFCQTYMEPMATKIMAETLEKNAIDKDEYPMTADLENRCVAMIGDLWHANPDE
EPMGTSTVGSSEACMLGGLAMLFRWKKLAKDAGIDIYTAQRPNLVISAGYQVCWEKFCRY
WDIEMRLVPLEKDHLSLNMDTVMDYVDDHTIGITAILGITYTGKFDDVKKLDELVEAYNQ
EHTDLPIRIHVDGASGAMVAPFVNPDLEWDFRLKNVWSINTSGHKYGLVYPGIGWVVWRS
KEALPEDLIFWVSYLGGEQATMAINFSRSASQIVGQYYVLMRNGFEGFKEIQERTLDVAR
YLALELDEMGIFEIYEDASNIPIVCWGLKEDAGVEWSLYDLSDRLRMSGWLVPAYPMPAD
MQDTTVQRVVARADFSMQLAIKLVEDMKKEIDTLNKAKFVTGNTQGVIQTGFNHGGRAAV
NHGDKEQTKAPTPQK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagcaatcagcaaccagcaaagttcttgacagcatggatgaaggtacaaagtacctc
accccgatttttggttcagaatcatccgacgcgcagatgccgcgtcttacgatgaacgat
cagccggtcgagccgcgtatcgcctacgagatgatcaaggagtatctgtctattgaaggc
aacgccacgcagaacctgaccacgttctgccagacctacatggagcccatggccacaaag
atcatggccgaaacccttgagaagaacgccatcgacaaggacgaataccccatgacggcc
gatctggagaatcgttgcgtcgccatgatcggcgacttgtggcacgcaaatcccgacgaa
gagcctatgggcacgtccacggtcggttcgtccgaggcctgcatgctgggcggtttggcc
atgctcttccgctggaagaagctcgcgaaggacgccggtattgacatctacaccgcgcag
cgcccgaatctggtcatttctgccggttaccaggtatgctgggaaaaattctgccgttac
tgggacatcgagatgcgcctcgtgccgcttgagaaggaccacctgtcgctgaacatggat
acggtcatggactatgtggacgaccacaccattggcatcacggctattctcggcatcact
tataccggtaagtttgacgacgtgaagaagctcgacgagttggtggaggcctacaaccaa
gagcacacagacctgcccatccgcattcatgtggacggtgcttcgggcgccatggtggcc
ccgttcgtgaaccctgacttggagtgggacttccgtctgaagaatgtctggtccatcaac
acgtccggccacaagtacggcctggtgtaccccggcatcggctgggtcgtgtggcgcagc
aaggaagcgctgcccgaggacctgatcttctgggtgagctatctgggcggcgagcaggct
acgatggccatcaacttctcgcgctcggcttcacagatcgtaggtcagtactacgtgctt
atgcgcaacggcttcgaaggcttcaaggaaattcaggagcgcacgctcgacgtggcccgc
tatctggcgctcgaactggacgagatgggtatctttgagatctatgaggatgcgtccaat
atcccgatcgtatgctggggcctcaaagaggatgccggtgtggagtggtcgctctacgac
ctgtccgatcgcttgcgcatgagtggctggctggttccggcgtatccgatgcccgccgac
atgcaggacaccaccgtccagcgtgtcgtggcccgcgccgacttctccatgcagctggct
atcaagctggttgaagatatgaagaaggagatcgacaccctgaacaaggcaaagtttgtc
accggcaatacccagggcgtcatccagaccggcttcaaccacggcggtcgtgccgctgtt
aaccacggcgacaaagagcagacgaaggcccccacgccccagaagtaa

DBGET integrated database retrieval system