KEGG   Eggerthella sp. YY7918: EGYY_19050Help
Entry
EGYY_19050        CDS       T01566                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
eyy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:eyy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EGYY_19050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eyy03400]
    EGYY_19050
Enzymes [BR:eyy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EGYY_19050
DNA repair and recombination proteins [BR:eyy03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EGYY_19050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: BAK45033
UniProt: F7UV10
LinkDB All DBs
Position
2072124..2074625
Genome map
AA seq 833 aa AA seqDB search
MAAKLDEYNRKRDFTQTPEPAGSTGADPEAGTDIDGRLKFAVQHHLASHDHYDLRLEWDG
ALLSWAVPKGPSFNPHDKRLAVHVEDHPLAYRTFEGTIPKGEYGGGTVMLWDEGYWEPLV
PVKEGLDKGDLKFILHGQRLKGAWVLVHIKPKPGERDDNWLLIKEKDSYIQPEAGIAKFN
ASVSTGRTMDEIARGEDERFAQNPFDKVNVELAKLVNAVPPGDEWLYEVKYDGYRIVAFV
EASQARLITRNHHDYTDHFPTLANSLAEWAAGRAMVLDGEVVVTDEAGRSDFQALQNFLR
HPAGKQPLYMVFDLLALDGDDLRTLPLGERKERLETLLNDAPEEVRYSVHVRGHGAESFH
AACSQRLEGVVGKRADAPYHGTRNGDWIKLKCDKRQEFVVGGWTRTAKKSDGVSSLLLGA
YENGTLVYVGRVGSGIGEDDARELLAKFVGLERSAAPFVNPPKARSGEKSFWLEPALVAE
VKFAEWTDDGQLRHPSYQGLRVDKDPRAVIREDPSDIEQPPPPTERKKDPMPATTASFIP
ATPAHATGDLVIDGVTITSSDKLLFKDPDVTKGDVVRYYAQVADAMLPYTSGRILSIVRC
PRGAGSACFFKKHPGPHEKGIHAIDVTGSDGEQDEYFYVDDAVGIVSEAQMDTLEFHLWG
SRVETLEQPDMMVFDLDPDKSLGLDLVRRGVRDLKSILDDLGLQTFLKTSGGKGYHVVIP
LQPEASWDAFHDFARRIAQVMAEKWPDRYTSNVRLAKRNGKIFIDWMRNGRGATSIAPYS
LRARSGARVSMPISWDELDDVAPDAVTMADALARLARGDNPWKGYFDVKQSLR
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaagctcgatgaatacaaccgcaaacgagatttcacgcagacccccgaaccc
gcaggctcgacgggagctgatcccgaggccggcaccgatatagacgggcggctcaaattt
gccgttcagcatcatcttgcaagtcacgaccattacgatctacgccttgagtgggacggg
gcgctgctcagctgggctgttccaaaaggaccgtccttcaatccgcacgacaaacgactt
gccgtacacgtggaggatcatcccctagcctaccgaaccttcgaagggaccattcccaag
ggtgaatatggcggcggcaccgttatgttgtgggatgaagggtactgggagccgctcgtg
cccgttaaggaagggctggacaagggtgatttgaagttcattttgcatggacaacggctc
aagggcgcatgggtgctcgtccacataaaaccaaagccgggtgagcgagatgataattgg
ctgctcatcaaggaaaaagatagctacatacagcctgaagcgggcatcgcgaagttcaac
gcctccgtttcgacaggccgcaccatggacgagatcgcacgcggagaagatgaacgcttt
gcccaaaatccgtttgataaggtaaatgtagagcttgccaagctggtaaatgcagtaccc
ccgggcgacgagtggctttacgaggtgaagtacgacggctatcgcatagtcgccttcgtt
gaagccagccaagcgcgcctcatcacgcgcaatcatcatgactacaccgaccacttcccc
actttggcgaactcacttgccgaatgggccgctggacgtgcaatggtgctcgatggcgag
gtggtggtgaccgacgaggcagggcgatcggattttcaagcgctgcagaacttcctacgc
caccccgcaggcaagcaacccctctacatggtgtttgatcttctggcgcttgatggcgat
gacctgagaacgcttccacttggcgagcgcaaagagcgtctggagactctgctcaacgat
gcgcccgaggaagtgcgctacagcgtgcacgtaagagggcatggtgctgaaagctttcat
gcggcatgttcgcagcgtttagaaggagtcgtgggcaaacgcgccgatgcaccctaccac
ggcacacgcaatggcgactggataaaactcaaatgcgacaagcgccaagagttcgttgtg
ggcggatggactcgcacagctaagaagtccgatggcgtaagttcacttctgttgggcgcc
tacgaaaacggcacgcttgtgtacgtgggacgcgtgggatcaggcattggcgaggacgac
gcccgcgaactgctggcaaaatttgtaggccttgagcgatcggcagcgccgtttgtgaac
cctccgaaggcgcgttcgggcgagaagagtttctggcttgaaccggcgctggtagctgag
gtgaagttcgccgaatggaccgacgatggacagttgcgtcaccccagctatcaaggcctt
cgtgtagacaaggacccgcgcgcagtcatacgcgaagaccccagcgacatcgaacaaccg
ccgcctcccactgagagaaagaaggaccctatgcctgctacaactgcatcctttatccct
gccactcctgcgcacgccacgggcgaccttgtcatcgatggagtgaccatcacaagctcc
gacaaacttctctttaaagaccccgatgtcacaaagggagatgtcgtgcgctactatgca
caggtggctgacgcgatgttgccgtatacgagcggacgtattttaagtattgtgcgctgt
ccgcgtggcgcgggatcggcatgcttcttcaagaagcatccgggaccgcatgagaagggt
atccacgccatagatgtaaccggaagcgatggcgaacaggacgaatacttctatgtggat
gacgcggtaggcatcgtatccgaggcgcagatggacacgctcgaattccacctatggggc
agccgggtagagacgcttgagcagcccgacatgatggtattcgacctcgatcccgacaag
agtctcgggcttgacctggtgcgtcgcggggtgcgcgatctcaaaagcatcctcgatgac
ctgggtcttcaaacgtttctcaagacgagcggcggcaaaggctatcacgtggtaataccg
cttcaaccagaagcgtcgtgggatgccttccacgacttcgcacgacgcatcgcccaggtc
atggccgagaagtggcccgaccgttacaccagcaacgtgcgattagccaaacgtaacggc
aagattttcatcgactggatgcgcaacggccgcggagccacaagtatcgccccctactcg
ctgcgcgctcgcagtggcgcacgcgtttcaatgccgataagctgggacgagttggacgat
gtcgcgcccgacgctgtgacgatggccgacgccctcgcgcgtctcgcccgcggtgacaac
ccgtggaagggatacttcgatgtgaagcagtcgttgcggtag

DBGET integrated database retrieval system