KEGG   Eggerthella sp. YY7918: EGYY_19620Help
Entry
EGYY_19620        CDS       T01566                                 

Definition
(GenBank) hypothetical protein
  KO
K02371  enoyl-[acyl-carrier protein] reductase II [EC:1.3.1.9]
Organism
eyy  Eggerthella sp. YY7918
Pathway
eyy00061  Fatty acid biosynthesis
eyy01100  Metabolic pathways
eyy01212  Fatty acid metabolism
Module
eyy_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:eyy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EGYY_19620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:eyy01004]
    EGYY_19620
Enzymes [BR:eyy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EGYY_19620
Lipid biosynthesis proteins [BR:eyy01004]
 Fatty acid synthase
  Component type
   EGYY_19620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH FMN_dh ThiG DUF561 His_biosynth ADH_zinc_N DHO_dh Glu_synthase Dus
Motif
Other DBs
NCBI-ProteinID: BAK45061
UniProt: F7UV38
LinkDB All DBs
Position
complement(2108328..2109305)
Genome map
AA seq 325 aa AA seqDB search
MNMNTRVTELLGIEVPLIQGAMARIADASLAGAVSEAGGLGIIACGGAPLEWVEEQVRIA
RSMTEKPIGANVMLMDPNATELAELLVKLHVDVITTGAGSPANYMAMWKEAGIKVVPVVA
SSALATRMERLGADAVIAEGTEAGGHIGELTTMALIPAVCDAVSIPVVAAGGIADGRGMV
AAFALGAEGVQVGTRFLTVDECTIADAYKEKVLAAKDADTIVTGRGSGHPVRCLKNKFAR
KVRSLEGDVAQNGDELEAMYVGSLRRAVEGDVDNGTMMAGQSAALVHGRGTAAEAIAQMV
AEAEALGAHDLAGLAGLNARRERAL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaacacgcgagtaaccgaacttttgggaatcgaggttcccctcattcaaggc
gcgatggcacgcatcgccgacgcaagcttggcgggtgcggtgagcgaagcgggcggtctc
ggcatcatcgcgtgtggcggcgcgccgcttgagtgggtggaggagcaagtacgcatcgcc
cgttcgatgaccgaaaagcccatcggtgcgaacgtcatgctcatggatccgaacgccacc
gagctcgccgagcttctggtgaagctgcatgtagacgttatcaccaccggtgcgggcagc
ccggcgaactatatggccatgtggaaggaagcgggcatcaaggtggtacccgtggtggcc
tcaagtgcgcttgcgacgcgcatggagcgtctaggcgcggatgctgtgattgccgagggt
accgaagcgggcggccacattggcgagcttaccacgatggctctcattccggccgtgtgc
gacgcggtatccatcccggtcgtcgcggcgggcggtatcgccgatgggcgcggtatggta
gcggctttcgcgctcggtgcggaaggcgtgcaggtgggcacgcgttttctgacggtagac
gaatgcaccatcgccgacgcgtacaaggagaaggtgctcgcagcgaaggacgccgacacg
attgtgaccggtcgcggcagcgggcatcccgtgcgctgcttgaagaacaagtttgctcgt
aaggtgcgctcgcttgagggcgatgtggcgcagaatggtgacgagctagaggctatgtat
gtgggatctttgcgtcgcgcggttgagggcgacgtggacaatggcaccatgatggctggc
cagtccgcggcactggtgcacgggcgcggcacggcggcggaggccatcgcacagatggtg
gctgaggctgaggcgctgggggcgcatgacctagctggtttggcgggtttgaatgctcgg
cgtgagcgggctttgtag

DBGET integrated database retrieval system