KEGG   Ficedula albicollis (collared flycatcher): 101805985Help
Entry
101805985         CDS       T02815                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04371  Apelin signaling pathway
fab04514  Cell adhesion molecules (CAMs)
fab04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101805985 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101805985 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101805985 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fab03036]
    101805985 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fab04515]
    101805985 (CDH1)
   04090 CD molecules [BR:fab04090]
    101805985 (CDH1)
Chromosome and associated proteins [BR:fab03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101805985 (CDH1)
Cell adhesion molecules [BR:fab04515]
 Cadherins
  Major cadherins
   101805985 (CDH1)
CD molecules [BR:fab04090]
 Proteins
  101805985 (CDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro
Motif
Other DBs
NCBI-GeneID: 101805985
NCBI-ProteinID: XP_005052288
LinkDB All DBs
Position
11
AA seq 882 aa AA seqDB search
MGLRAGCSVPLCLLLLLLQSGQRLCQRAASCQPGFTAETFALTVPRDSVAAGRALGRVNF
EDCGESRRAAFLPDDTRFKVSRDGIVSATRPLQLQHRDITFAVHTWDATGKKHSAKVTLR
HRRHQHRHHERMQQDTVPDVLIFPEHGHGLRRQKRDWVIPPINCPENERGPFPKKLVQIK
SNKDKETKVFYSITGQGADTIPVGVFIIERETGWLEVTKPLDREEKDKYVLYSHAVSANG
QPVEDPMEIIITVTDQNDNRPVFTQQVFVGYIEENAKPGTSVMTVNATDADDAINVNNGI
IGYSIISEEPKGAQRMFTINAEKGIISVIGTGLDRETTPNYTLIIQAADQEGNGLTNTAT
AIIKVTDANDNPPVFDPTTYEDAVDENEVGVLVARLHVTDQDLPGSPAWNAVYRIKSGDP
QGNFEITTDPKTNDGLLKTAKGLDYETQNRYTLVVSVQNDVPFTVDVNPATATVLVVVRD
VNEAPIFIPPVKRVDVMEDVPVGYHVTSYTAQDPDKEQSQKITYRMGSDPAGWLAIDPEN
GIVTAAQPLDRESAHAINSTYKAIVLAVDNGSPHDATGTGTLLLVLQDVNDNGPVPEPRS
FDICNRQPEEQTLTIIDKDLPPNTYPFKAELMHGSSSNWTVKLVTPDLVKVNMKKELEPG
EYSIFLKLLDGQGKEQITPVRAQVCSCEGPAKNCERRAYISGGMGVPAILGILGGILALL
ILLLLLLLFVKRRKVVKEPLLPPEDDMRDNVYHYDEEGGGEEDQDYDLSQLHRGLDARPE
VIRNDVAPPLMAAPQYRPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSE
ATSLSSLNSSASDGDQDYDYLNDWGGRFRKLAELYGGGEEDD
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcgggcgggttgctcggtccccctctgccttctcttgctcctgctccagagc
gggcagcggctgtgccagcgggcagcgtcgtgccagcccggcttcaccgccgagaccttc
gctctgacggtgccgcgggacagcgtggcggcgggacgggcactgggacgagtgaacttt
gaggactgtggcgagtcgcgccgtgccgccttcctcccggacgatacacgcttcaaggtg
agcagggatggcattgtctctgccacccggcccctgcagctccagcatcgggacatcacc
tttgccgtgcacacctgggatgccacgggcaagaagcattcagccaaggtgaccctgcgc
caccggcggcaccagcaccgccaccacgagcggatgcagcaggacacagtacctgatgtg
ctgatcttcccggagcatggacacggcctccggcgacagaagagggactgggtcatcccc
cccatcaactgccctgagaatgagcggggccccttccccaagaagctggtgcagatcaaa
tccaacaaggacaaggagaccaaggttttctacagcatcacggggcagggagcagatacc
atccccgtgggtgtcttcatcatcgagcgggagacggggtggctggaggtgacaaaaccc
ctggatcgggaggagaaggataaatatgtgctctactcccacgccgtgtcagccaacggg
cagcccgtggaagaccccatggagatcatcatcaccgtcactgaccagaacgacaaccgg
cccgtcttcacccagcaagtctttgttggctacattgaggagaacgcaaagccgggcaca
tctgtgatgaccgtgaacgctacggatgcagatgatgcgatcaatgtgaacaatggcatc
attggttattccatcatcagtgaggagcccaagggtgcacagcggatgttcaccatcaat
gccgagaagggcatcatcagtgtcattggcacaggactggaccgggagaccactcccaac
tacacgctgatcatccaggctgcagaccaggagggcaatggcctgaccaacactgccact
gccatcatcaaagtcactgatgccaacgacaaccctcctgtcttcgaccccaccacgtat
gaggatgcagtggatgagaacgaggtgggggtgctggtggcccggctgcatgtgacagac
caggacctgccaggctccccggcctggaacgctgtctaccgcatcaagagtggggaccca
cagggcaacttcgagatcaccactgaccccaaaactaacgatgggctcctgaaaactgcc
aagggcctggattacgagacccagaaccggtacacgctcgtggtgtcagtgcagaatgat
gttccctttactgtggacgtgaatcctgccacagccactgtcctggtggtggtcagggac
gtgaatgaagcccccatcttcatacccccagtgaagcgggtggatgtgatggaggatgtg
ccagtgggatatcacgtcacctcctacacagcccaggaccccgacaaggagcagagccag
aaaatcacgtatcgcatgggcagtgaccccgcggggtggctggccattgaccctgagaac
ggcatcgtcacggcagcccagccactggaccgcgagtcggcgcacgccatcaacagcacc
tacaaagccatcgtcctggccgtggacaacgggtcaccacacgatgccaccggcacgggg
acgctgctgctcgtgcttcaggatgtgaacgacaacgggcccgtgccagagccacggagc
ttcgacatctgcaaccggcagcccgaggagcagacactgaccatcattgacaaggacctg
ccccccaacacctaccccttcaaggcagagctgatgcacggctccagcagcaactggact
gtcaagttggtgacaccagacctagtgaaggtgaatatgaagaaggagctggagccgggc
gagtacagcatcttcctgaagctgctggatgggcagggcaaggagcagatcacgccggtg
cgagcccaggtctgcagctgcgaggggccagccaagaactgcgagcgacgagcgtacatc
tcgggtggcatgggcgtgcccgccatcctgggcatcctggggggcatcctggcgctgctc
atcctcctcctgctgctgctgcttttcgtgaagaggaggaaagtagtgaaggaaccactg
ctgccacccgaggatgacatgagggacaatgtgtaccactatgatgaggagggcggtggc
gaggaggaccaggactacgacctgagccagctgcaccgggggctggacgcccggcccgag
gtgatccgcaacgacgtggcccccccgctcatggcagctccccagtaccggccccgcccc
gccaaccccgacgagatcgggaacttcatcgacgagaacctgaaggcggccgacacggac
cccacggcccccccctacgactcgctgctggtgtttgactacgagggcagcggctcggag
gccacctcgctcagctccctcaactcctccgcgtccgacggcgaccaggactacgactac
ctcaacgactggggcggccgcttccgcaagctggccgagctctatggcggcggcgaggag
gatgattag

DBGET integrated database retrieval system