KEGG   Ficedula albicollis (collared flycatcher): 101806310Help
Entry
101806310         CDS       T02815                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04144  Endocytosis
fab04150  mTOR signaling pathway
fab04270  Vascular smooth muscle contraction
fab04310  Wnt signaling pathway
fab04350  TGF-beta signaling pathway
fab04510  Focal adhesion
fab04520  Adherens junction
fab04530  Tight junction
fab04621  NOD-like receptor signaling pathway
fab04625  C-type lectin receptor signaling pathway
fab04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101806310 (RHOA)
   04350 TGF-beta signaling pathway
    101806310 (RHOA)
   04150 mTOR signaling pathway
    101806310 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101806310 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101806310 (RHOA)
   04520 Adherens junction
    101806310 (RHOA)
   04530 Tight junction
    101806310 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101806310 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101806310 (RHOA)
   04625 C-type lectin receptor signaling pathway
    101806310 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101806310 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fab04131]
    101806310 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101806310 (RHOA)
   04031 GTP-binding proteins [BR:fab04031]
    101806310 (RHOA)
Membrane trafficking [BR:fab04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    101806310 (RHOA)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101806310 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   101806310 (RHOA)
  Exosomal proteins of colorectal cancer cells
   101806310 (RHOA)
  Exosomal proteins of bladder cancer cells
   101806310 (RHOA)
GTP-binding proteins [BR:fab04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    101806310 (RHOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 101806310
NCBI-ProteinID: XP_005053107
LinkDB All DBs
Position
12
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLLL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcagccattcgaaaaaagctggttatagtgggagatggtgcctgtggaaagacctgt
ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa
aattacgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca
gcaggacaggaagactacgatcgacttagaccgctttcttatccagatacggatgttata
cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc
ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaaaaaggac
ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaag
cccgaggaaggccgggatatggcaaaccgcattggtgcattcgggtacatggagtgttcg
gcaaagaccaaagacggtgtgagggaggtgtttgaaatggccactagagctgctttgcaa
gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system