KEGG   Ficedula albicollis (collared flycatcher): 101806443Help
Entry
101806443         CDS       T02815                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101806443 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fab04052]
    101806443 (THPO)
Cytokines and growth factors [BR:fab04052]
 Cytokines
  CSF and other factors
   101806443 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 101806443
NCBI-ProteinID: XP_005051273
LinkDB All DBs
Position
9
AA seq 235 aa AA seqDB search
MQGRSPQPSMELNRLLLLTSFLLHVKEDRASPTRLVCDNRLIQKYIVEAKDMEKGVGQCQ
ALPPLSCPAVLPLVDFTFQQWKSKSNETKRREILCDLALLVGAAAAAQGQVSNECGARQL
SQLYRHANSFFLLLQTFSWEVRAPHMNQTTLAQVPAGLGWEQWCLSPLCPTLAPQAGHWE
PSCSPHSMEQTHITSIFLTYRQLVQGKLSFFFYDLAKILCKQGQGDSRDPPCGAR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcagggccgaagcccccagccgagcatggagctgaacagactgctcctcctcacatcc
ttcctcctgcacgtgaaagaggaccgtgccagcccaacacggctggtctgtgacaacaga
ctcatccagaaatatatcgtggaggccaaggacatggaaaagggagtgggccagtgccag
gccctgcctccactcagctgccctgcagtgctgcccttggtggacttcactttccagcag
tggaaatccaaatcgaacgagaccaagcggcgggagatcctgtgtgacctggccctgctg
gtgggtgctgcagcagcggcccagggccaggtgagcaacgagtgtggggccaggcagctc
agccagctttaccgacatgccaactccttcttcctgctcctgcagaccttcagctgggag
gtgagagctccccacatgaaccagaccaccctggcacaggtgccagctgggctgggttgg
gagcaatggtgtttgtcacccctctgtcccactctcgcccctcaggcaggacactgggag
ccgagctgctccccacactccatggagcagacccacatcaccagcattttcctcacctac
cggcagctggtacagggcaagttgagcttcttcttctacgacctggccaagatcttgtgc
aagcaaggacagggggacagcagagaccctccatgcggggcccggtga

DBGET integrated database retrieval system