KEGG   Ficedula albicollis (collared flycatcher): 101806626
Entry
101806626         CDS       T02815                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101806626 (CACNA1E)
   04020 Calcium signaling pathway
    101806626 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fab04040]
    101806626 (CACNA1E)
Ion channels [BR:fab04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101806626 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 101806626
NCBI-ProteinID: XP_016155496
LinkDB
Position
8
AA seq 2178 aa
MGPVSPDVIKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGSGDG
GSDQNRSRQGAPAPAGGSPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEENI
VRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCF
EAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRP
LKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSG
ELEELDPPHPCGVQGCPPGYECREWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYN
TNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIE
RELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRNRTDAMSGDEHCVDISSVGE
RRLAQRRPLHPTLGNPSSHSGLKGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSL
VALNTACVAIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDC
GVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIIS
LLFLLFLFIVVFALLGMQLFGGRFNFMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYN
GIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQ
KHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQL
RRHMQMSSQEGINKDEPPLINPHASIFRRKRPGEGVTLEKCAEEQGKGERPLAEGPEQPV
PGANPGGGEAKRDKDMWQQKSCHGNCEPGEQDGAGGSIEDRARMRQSQRRSRHRRARVEG
KDTAGILGSRSASQETGLEEASAAGGAQEGDRRGDAAAAEALIPGEPEASGESIRTNGVP
AGDADLMGSARKGSPAHAAPELCQGKAAEQECSSPDTSEQALLEPSRTVSRSEPDLSSVA
PNAEKATESTAIMIDVHDSAVVQISNKTDGEASPLKEAETKEDEEEMEKKKRKKEKSETG
KAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNK
VLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALG
TNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFA
VIAVQLFKGKFFYCTDSSKDTQKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLT
LFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIII
TFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTI
MAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNI
FDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSF
KALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEA
WQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMD
NFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRISYKDMYKLVRVISPPLGLGENCPYR
VACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWP
HLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEP
SSLPQEIISNAKALPYLQQDTLSGLSSRGGFPSLSPLSPQEIFQLACMDPAQEQYQEHQS
LEPEVREFQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIR
DKRPNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADSGHRSEGHRSGRERGRS
KERKHLLSPDISRCNSEERSPQAQEESPERRRESRSPSEGRSQTPSRQGMGSLSESSIPS
ISDTSTPRRGRRQLPPVP
NT seq 6534 nt   +upstreamnt  +downstreamnt
atggggcccgtgagccccgacgtgatcaagcggcggcgaggggggctcatcgagcagagg
gacatcatcaaggcgcacgaggcacacaagatgcagagcacgccccaggcacgcaggaag
gagtgggagatggctcgctttggggaggcagtggccggcaggctgggctctggagatggg
ggctccgaccagaaccggagccggcaaggagctcctgcccctgcgggagggagcccggga
gccttcaagcaaaccaaagcgcagagagcccggactatggctctgtacaaccccatcccc
gtccggcagaactgcttcaccgtcaacagatcgctcttcctctttggggaagagaacata
gtcaggaaatacgccaagaagctcatcgactggcctccctttgagtacatgatcctggcg
accatcattgccaactgcatcgtgctggccctggagcagcacctccccgaggatgacaag
acgcccatgtcacggagattagagaagacagagccctacttcattgggattttctgcttc
gaggctgggattaagatcgtggcgctggggttcgttttccacaagggctcgtacctgcgc
aatggctggaacgtcatggacttcattgtggtcctcagcggcatcctggccacggccggg
acacacttcaacacccacgtggacctgcggacgctgcgcgccgtgcgcgtgctccggcct
ctgaagctcgtctcgggcattcccagcttgcagattgtcctgaaatccatcatgaaggcc
atggtgcctctcctccagattggcctgctgctcttttttgctatcctcatgtttgccatc
attggcctggagttctatagcgggaagctgcaccgagcctgctacacgaacaattcaggt
gaactggaggagctggaccccccccatccctgcggggtgcagggttgccccccgggctac
gagtgccgggagtggatcggtcccaacgacgggatcacgcagttcgacaacatcctcttt
gctgtgctgaccgtcttccagtgcatcaccatggaagggtggaccacagtcctgtacaac
accaatgatgccttaggagccacctggaactggctgtacttcatccccctcatcatcatt
ggatccttctttgtcctcaaccttgtcctgggagttctgtcaggggagtttgccaaagag
cgagagcgcgtggagaaccgccgagccttcatgaagctgcggcgccagcagcagatcgag
cgggagctcaacggctaccgggcgtggatagacaaagcggaggaagtcatgctggctgaa
gagaacaagaattcggggacctcagccttagaagtgctcaggcgagccaccatcaagcgg
aaccggacggatgccatgtcgggtgacgagcactgtgtcgacatctcctctgtgggcgag
cggaggctggcgcagagaagacctctccatccaaccttgggtaacccctcgagtcactct
ggcctcaaaggtgccagggtggacggtgcctcctacctgcggcacaaggagcggctcctg
cgcatctccgtccgccacatggtgaaatcccaggtcttctactggatcgtcctgagcctg
gtggctctcaacactgcctgcgtggccatcgtccatcacaaccagccagcctggctcacc
cacttcctctactatgcagagttcctgtttcttgggctcttccttctggagatgtcctta
aagatgtacgggatggggccacgcctttacttccattcttccttcaactgcttcgactgt
ggggtcacagtgggaagcatctttgaagtggtttgggctatattcagaccaggaacctct
tttgggatcagtgtcctacgagctcttcgtctcctgcggatatttaaaataaccaagtac
tgggcatccctgaggaatttggtggtctcgctgatgagctccatgaaatctattatcagt
ctgctcttcctcctcttcctcttcatcgtggtctttgccctgctgggaatgcagctgttt
ggaggcaggtttaacttcatggatgggaccccatcggccaacttcgacaccttccctgca
gccatcatgacggtgtttcagatcctgacgggcgaggactggaacgaggtgatgtacaac
ggcatccgctcccagggaggcgtgcgctcggggatgtggtcctccatctacttcatcgtc
ctcaccttgtttgggaactatactctgctgaatgtcttcttggccattgccgtggacaac
ctggccaacgcccaggagctcaccaaggacgagcaggaggaagaggaggccttcaaccag
aagcacgcccttcagaaagccaaagaagtcagccccatgtctgccccaaacatgcctgct
atcgaaagagacaggcggaggagacaccacatgtcgatgtgggagccacgcagcagccac
ctgcgggagcgtcgccggcggcaccacatgtcggtgtgggagcagcgcaccagccagctg
cgccggcacatgcagatgtccagccaggagggcatcaacaaggacgagccgcccctcatc
aatccccacgccagcatcttccgcaggaagagacccggggagggcgtcaccctggagaaa
tgcgccgaggagcagggcaagggcgagcggccgctggccgagggacccgagcagccggtc
ccgggggccaaccccggcggtggcgaggccaagcgggacaaggacatgtggcagcagaaa
tcctgccatgggaactgtgagccgggagaacaggacggggcgggaggcagcatcgaggat
agagccaggatgagacagagccagcggcgcagccggcaccgccgagcccgcgtggagggc
aaggacacggcgggcatcctggggagccgctcagccagccaggagacggggctggaggag
gccagcgctgccgggggggcgcaggagggggaccggcgcggggacgcggctgcagcagag
gcgctgattccaggggagccggaggcgagcggcgagtccatcaggacaaacggggtcccc
gctggcgatgccgatctgatggggagcgccaggaaggggagccccgcacacgccgcgccc
gagctgtgccaggggaaggcggcggagcaggagtgcagcagcccggacacgagcgagcag
gcgctgctggagcccagccgcaccgtgagccgcagcgagcccgacctctcctccgtcgcc
cccaacgccgagaaggccaccgagagcacggccatcatgatcgatgtccacgactccgct
gtggtacagattagcaacaagacagacggcgaagccagccccttaaaggaggccgagacc
aaggaggatgaggaagaaatggagaagaagaagcggaagaaggaaaagagcgagacgggc
aaagcgatggtgccgcacagctccatgttcatcttcagcaccaccaacccggtgaggagg
gcctgccactacatcgtgaacctgcgctacttcgagatgtgcatcctcctggtgatcgcc
gccagcagcatcgccctcgccgccgaggatcccgtcctcaccaactccgaccgcaacaag
gtgctgaggtatttcgactatgtcttcactggagtcttcaccttcgagatggtgatcaag
atgattgatcagggcttgatcctgcaggacggctcctacttccgagacctctggaacatc
ctggatttcatcgtggtggtgggagcgctggtggcttttgccttggcgaatgctttgggg
accaacaagggccgggatatcaagaccatcaagtctctccgtgtgctgcgggtcttgagg
cccctgaaaaccatcaagagactgcccaagctaaaggctgtttttgactgcgtcgtgaca
tctctcaagaacgtcttcaacatcctcattgtctacaagctcttcatgttcatcttcgcc
gtcatcgccgtgcagctcttcaaggggaagttcttctactgcacggacagctcgaaggac
acgcagaaggactgcatagggaactacgtggaccatgagaagaacaagatggaggtgaaa
tgccgggagtggaagcggcacgagttccactatgacaatatcatctgggctctgctcacc
ctgttcaccgtgtccaccggcgaggggtggccccaggtgctgcagcactcggtggatgtg
acggaggaggaccgcgggcccagccgcagcaaccgcatggagatgtccattttttatgtc
gtctactttgtggtcttccccttcttcttcgtcaacattttcgtggctctcatcatcatc
acgttccaagagcaaggagacaaaatgatggaggagtgcagcctggagaagaacgagagg
gcctgcattgacttcgccatcagcgccaagcccctgacgcggtacatgccccagaacagg
cacaccttccagtaccgcgtgtggcacttcgtggtgtccccgtccttcgagtacaccatc
atggccatgatagcgctcaacaccgtggtgctcatgatgaagtactattctgctccatac
acctatgagctggccctgaagtacctgaacattgccttcaccatggtgttctccttggag
tgtgtcctcaagatcatcgcgttcggcttcctgaattatttccgggacacctggaacatc
tttgacttcatcacggtcatcggcagcattacggagatcatcctgacggacaccaagctg
gtgaacaccagcagcttcaacatgagcttcctgaagcttttccgggctgctcgtctcatc
aagctgctccgccagggctacaccatccgcatcctgctctggacgtttgtgcagtccttc
aaggcgctcccctatgtctgcctcctgattgccatgctgttcttcatctacgccatcatt
gggatgcaggtttttggcaatatcaaactagatgaggaaagccacattaaccggcacaac
aacttccgcagcttcctgggctccctcatgctgctcttcaggagtgccaccggagaggcg
tggcaggagatcatgctgtcctgcctggagggcaaaggctgcgagccggacaccacggcc
acgtccgggcagaacgagaacgagcgctgcggcaccgacctggcctatgtctactttgtg
tccttcatcttcttctgctccttcctgatgctcaacctgtttgtggcagtcatcatggac
aactttgaatacctgacacgggattcctccatcctgggccctcaccatctggatgagttt
gtccggatctgggcagagtatgaccgagcagcgtgcggcaggatctcgtataaggatatg
tacaaattagtacgggtgatctcgcctcctctgggcctaggagagaactgcccctacagg
gtggcgtgcaagagactggtgctgatgaacatgcccgtggccgaggacatgacagtgcac
ttcacctccaccctcatggcgctgatccgcacggccctggacatcaaaattgccaaaggt
ggtgcagattggcagcaattggactccgagcttcaaaaggagatcctgaccatttggcct
cacctgtcccagaagatgcttgacctgttggtacccatgccaaaaacctctgacctgact
gttgggaaaatatatgcagccatgatgatcatggattactacaagcagagcaaggcgaag
aagcagcggcagcagctggaggagcagaaaaatgcccccatgttccagcgcatggagccg
tcctccctgccgcaggaaatcatctccaacgcaaaggctctgccgtacctccagcaggac
accctctcgggcctgagcagccgaggcgggttcccctcgctgagcccgctctcgccgcag
gagatcttccagctggcgtgcatggatccggcccaggagcagtaccaggagcaccagtct
ctggagccagaggttagggagtttcaaagagtgcagccctctaaccgtggcagctacctt
cccgtggacactcaggaccacgctgtctctgggagggcctcctccatgcctcgtctcact
gtggatccccaggtggtgacagacaccagctccatgcggagatcgttctccaccatccgg
gacaagcggcccaacagctcctggctggatgagttctccatggagcgcagcagcgacaac
acctacaagtcccgccggcgcagctaccactcctcgctccagctgtccgcccggcgcctc
aacgccgactcgggccaccggtccgaggggcaccgctcgggcagggagcggggccgatcc
aaagagcgcaagcacctgctgtcccctgacatctcccgctgcaactccgaggagaggagt
ccccaggcacaggaggagtccccggagcggcggcgcgagtcccggtcacccagcgagggc
aggtcacagacacccagcaggcagggcatgggctccctgagcgaaagctccatcccctcc
atctcggacaccagcactccccggcgcggccgccgccagctgccgccggtgccc

DBGET integrated database retrieval system