KEGG   Ficedula albicollis (collared flycatcher): 101806876Help
Entry
101806876         CDS       T02815                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04012  ErbB signaling pathway
fab04020  Calcium signaling pathway
fab04114  Oocyte meiosis
fab04217  Necroptosis
fab04261  Adrenergic signaling in cardiomyocytes
fab04310  Wnt signaling pathway
fab04912  GnRH signaling pathway
fab04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101806876 (CAMK2D)
   04310 Wnt signaling pathway
    101806876 (CAMK2D)
   04020 Calcium signaling pathway
    101806876 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101806876 (CAMK2D)
   04217 Necroptosis
    101806876 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101806876 (CAMK2D)
   04916 Melanogenesis
    101806876 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101806876 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101806876 (CAMK2D)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101806876 (CAMK2D)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101806876 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_4 SnoaL_2 DUF4915
Motif
Other DBs
NCBI-GeneID: 101806876
NCBI-ProteinID: XP_005044629
LinkDB All DBs
Position
4
AA seq 514 aa AA seqDB search
MMASTTCTRFTDEYQLFEELGKGAFSVVRRCMKITTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKTNVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALG
NLVEGMDFHRFYFENALSKANTKPIHTIILNPHVHLVGEDAACIAYIRLTQYMDGSGMPK
TMQSEETRVWHRRDGKWQNVHFHRSGSPTVPINA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctcgaccacctgcacacgcttcaccgacgagtaccagctcttcgaggagctc
ggaaaaggggcgttctccgtcgtgaggaggtgtatgaaaatcaccacaggacaagagtac
gctgccaaaattatcaacaccaaaaagctttcagctagggatcaccagaaactggaaaga
gaagctagaatctgtcgcctcctgaagcatcctaatatcgtgcggctccatgacagcata
tcagaagaaggattccattacttagtctttgacttagtcactggaggtgaattgtttgaa
gatatagttgcaagagagtattatagtgaagcagatgccagtcattgtatacagcagatt
ctagaaagtgttaatcattgtcatctaaatggcatagttcacagagacctgaagcctgag
aacttacttctagctagcaaatccaagggagcagcagtaaaactggcagactttggattg
gctatagaagtccagggagaacaacaggcttggtttggctttgctggtactccaggatac
ctttctccagaagtgttacgaaaagatccttatggaaaacctgtggatatgtgggcatgt
ggagtcattctgtacatcctcctggtgggataccctcccttctgggatgaagaccagcac
aggctgtaccagcagatcaaggctggtgcttatgatttcccctcaccagaatgggacaca
gtgactcctgaagcaaaagaccttatcaataaaatgctcaccatcaacccagcgaaacgt
atcacagcatcggaagcactaaagcacccatggatctgtcaacgttctactgttgcctct
atgatgcacagacaagagactgtagattgcttgaagaaattcaatgcaagaagaaaacta
aagggggccattttgacaacaatgctggctaccagaaatttctcagcagccaagagttta
ctgaaaaagccggatggagttaagataaacaacaaaaccaacgtggtaaccagccccaag
gaaaatattcctaccccggcgctggagccccaaactacagtaatccacaaccctgatgga
aataaggaatcaacagagagttccaacacgaccatcgaagatgaggatgtgaaagctcgt
aagcaggagattatcaaggtgaccgagcagttgattgaagccatcaacaatggggacttc
gaagcttacacaaaaatctgtgacccaggccttacgtcttttgaacctgaagctttgggt
aatctggtagaagggatggacttccaccggttttacttcgaaaatgctctgtccaaggct
aacaccaagccgatccacacgatcatcctgaacccgcacgtgcacctggtgggcgaggac
gcggcgtgcatcgcctacatccgcctgacgcagtacatggacggcagcggcatgccaaag
actatgcagtccgaggagacgcgcgtctggcaccggcgcgacggcaagtggcagaacgtg
cacttccaccgctcgggctcgcccaccgtacccatcaatgcctag

DBGET integrated database retrieval system