KEGG   Ficedula albicollis (collared flycatcher): 101806923Help
Entry
101806923         CDS       T02815                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00010  Glycolysis / Gluconeogenesis
fab00053  Ascorbate and aldarate metabolism
fab00071  Fatty acid degradation
fab00260  Glycine, serine and threonine metabolism
fab00280  Valine, leucine and isoleucine degradation
fab00310  Lysine degradation
fab00330  Arginine and proline metabolism
fab00340  Histidine metabolism
fab00380  Tryptophan metabolism
fab00410  beta-Alanine metabolism
fab00561  Glycerolipid metabolism
fab00620  Pyruvate metabolism
fab01100  Metabolic pathways
Module
fab_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101806923 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    101806923 (ALDH7A1)
   00620 Pyruvate metabolism
    101806923 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101806923 (ALDH7A1)
   00561 Glycerolipid metabolism
    101806923 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101806923 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    101806923 (ALDH7A1)
   00310 Lysine degradation
    101806923 (ALDH7A1)
   00330 Arginine and proline metabolism
    101806923 (ALDH7A1)
   00340 Histidine metabolism
    101806923 (ALDH7A1)
   00380 Tryptophan metabolism
    101806923 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101806923 (ALDH7A1)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101806923 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     101806923 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101806923 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 101806923
NCBI-ProteinID: XP_016160108
UniProt: U3JIT7
LinkDB All DBs
Position
Z
AA seq 475 aa AA seqDB search
VVTTYCPANNEPIASVRQGNLEDYEETVKKAKEAWKVWADIPAPKRGEIVRQIGDALRQK
IKVLGSLVSLEMGKIFVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHALIEQWNP
VGLVGVITAFNFPVAVYGWNSAIAMICGNACLWKGAPTTSLVSVAVTRIIAKVLEDNKLP
GAICSLVCGGADIGTAMARDERMDLLSFTGSTKVGKQVALMVQERFGRSLLELGGNNAII
VFEDADLNLVIPSALFASVGTAGQRCTTARRLFLHESIHDEVVAKLAKAYAQVRIGDPWD
SDTLYGPLHTKEAVKMFLDAVEQAKQQGGSVVCGGKVINRPGNYVEPTIVTGLPHNAPIV
HTETFAPILYVLKFKEEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVN
IPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaccacgtactgccccgccaacaacgagcccatcgccagcgtccggcagggtaat
ttggaggattatgaagaaacagtaaagaaggctaaagaggcatggaaggtctgggctgat
atccctgcacctaaacgtggagaaatagtgcgacagattggtgatgccctgagacagaaa
atcaaagtcctaggaagtttggtctctttggaaatgggaaagatttttgtcgagggtgtt
ggggaagtgcaggagtatgttgatgtctgtgactatgctgttggtttgtcccgaatgatt
ggtggtcctattttgccttcagaaagacctggccatgcccttatagagcagtggaatcct
gttgggctagtaggagtcatcacagccttcaacttccccgtggcagtttatggatggaac
agcgcaattgccatgatctgtggaaacgcttgcctctggaagggtgctcctacaacatcc
cttgttagtgttgctgttacaaggataattgccaaagtgttggaggataacaagttgcct
ggagcaatctgctctctggtttgtggtggagcagacattgggacagcaatggcgagagat
gagaggatggacctcttatccttcactggcagcacaaaagtgggcaagcaagtagcactt
atggttcaggagagatttggtcgaagcctgctggagttgggaggaaacaatgccattatt
gtgtttgaagatgcagatctgaacctagtcatcccgtctgctttatttgcttctgtggga
acagcaggccagaggtgcacaactgctagaaggctgtttctccatgaaagcatccatgat
gaggtggtggcaaagcttgccaaggcctatgcccaggtccgcatcggtgatccatgggat
tctgacactctgtatgggcctcttcataccaaagaagctgtgaaaatgttccttgatgca
gtagaacaagcaaaacagcaaggtggctctgtggtctgtggtggaaaggttataaatcgc
cctggaaactatgttgaaccaaccattgtgaccggccttcctcataatgcgcccatcgtc
cacactgagacatttgcccccatattgtatgtgctgaaatttaaggaggaagaggaggtt
tttgcctggaataatgaagtaaaacaaggtctttccagcagtatctttaccaaggatttg
ggaaggattttccgctggcttgggcccaagggatctgactgtggcattgtgaatgttaac
atcccaaccagcggagctgagattggaggtgcttttggtggtgaaaagcacaccggtggg
ggaagagaatctggaagtgattcatggaaactttatatgagacggtctacttgtacaatc
aactacagcaaagatttgcccttggctcaaggaatcaagtttcagtaa

DBGET integrated database retrieval system