KEGG   Ficedula albicollis (collared flycatcher): 101807450Help
Entry
101807450         CDS       T02815                                 

Gene name
SI, MGAM
Definition
(RefSeq) sucrase-isomaltase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00052  Galactose metabolism
fab00500  Starch and sucrose metabolism
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101807450 (SI)
   00500 Starch and sucrose metabolism
    101807450 (SI)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101807450 (SI)
    3.2.1.20  alpha-glucosidase
     101807450 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101807450
NCBI-ProteinID: XP_005051458
LinkDB All DBs
Position
9
AA seq 1805 aa AA seqDB search
MGRKFSGLELSLIALVTVLTVVACVLIGLLATGEPGVKSPDFYPQCQNIPTAERIDCIPD
QLATKSTCSLRGCCWSPQSDTSVPWCFFSAKHGYKVKGSKRATQAGFEATLKRLPSPSLF
GNDIQTVLLTAEYQTRNRFRFKITDPKTERFQVPHEHVQPFQGSEAADPSYRVELRQNPF
SLVVTRSSNGRVLFDTSIGPLQYADQFLQLSIKLPSSNIYGVGEHVHKQYRHNVNWKTWP
IFSRDTGPSAAMDNLYGAHTFFLCLEDNTGASFGVFLMNSNAMEFVVQPAPAVTYRTIGG
ILDFYIFLGDTPEQVVQEYLQLVGLPALPSYWSLGFQLSRYGYASLDEVKEIVERNRAIG
LPYDAQVIDIDCMEQRKDFTYDKEKFKDLPQFANYLHEREQKYIIILDAAIGTQKMLDGS
DYGAYIRGSEKNVWVNESDGTTPLYGEVWPGETVFPDFTSSTGTDWWAEECRLFHGEVPY
DGIWIDMNEVCNFVQGSKGGCAQNDLNYPPYTPRILDRLMYSKTLCLDAVQAWGKQYDVH
NLYGYSMTIASRKAIEKVFPGKRSFLISRSTFAGSGKHGGHWLGDNAATWDQLRWAIPGM
LEFNLFGIPYVGADICGFSENTTEELCRRWMQVGAFYPFSRNHNGEYVIHQDPAAFGPDS
LLVNSSKHYLSIRYTLLPYLYTLLYRAHTRGDTVVRPLLHEFYSDETTWDIDRQFLWGPG
LLISPALEPGVESTRVYFPDAEWYDYDTGAPTSVRKVWHDLETPADKMGVHLRGGYIFPT
QEPNSTTVTSRRNPMGLIIALDLNHEASGDLFWDDGESTGTIETKTYIYYEFKVSNNTLQ
MTVIHSNYTDPNNLKFEEIKILGLSQAITSVTVYQNNVVQEYISNTTYDLMTKVAVIRGL
QLELGKPYTITWTPDVNERFDCYPGQDATKEKCEQLGCSWELAENGKVPACYYKSSNPYS
AENVSYSPSGIEATLRVDSSKVRANENSTAPISTLRLEVKYHRNNMLQFKIYDDQNPRYE
VPVPLNLPSSPSPSEDRLYEVSIQDRPFGIEIRRKSTGTVIWNSGLPTFTFSDMFIQIST
RLPSQYIYGFGEVEHLNFRHDMNWETWGMFTRDQPPGYKMNSYGFQPFYMALEEDGNAHG
VLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVVKEYTELVGRPVMPAYWSL
GFQLCRYGYANDSEIAQLVEEMKAARIPYDVQYSDIDYMERNLDFTLSPHFAGLPALINK
IKAEGMRFIIILDPAISGNETDYPAFSRGVEQDVFIKWPDSNEILYNKVWPFLPNVEIDE
SLPHEQVVERFGAHCAFPDFFRNSTAEWWKNEILEVYNNTNASKSLKFDGLWIDMNEPAS
FINGATGGCKNDLLNNPPYMPNLAYRSEGLAYKAPCMEAQQYLADGTPLRHYDVHNLYGW
SQTKITLEALQAATNERGIVITRSTYPSSGRWAGHWLGDNTAAWNQLHKSIIGMMEFSLF
GISYTGADICGFFSDAEYEMCARWMQLGAFYPFSRNHNGKGTVRQDPAFWNSTFHDISRN
VLNIRYTLLPYLYTLLFDAHAHGSTVVRPLLHEFVEDRVTWDIDEQFLWGPALLISPVLK
QNDRTVNAYFPNARWYDYHTDTDTGFRGQFQNLSAPLELINLHIRGGYILPWQTPANTTA
YSRKNPMGLTVALDDALFAEGHLYWDDGVRIDAYEDGVYLLTSFTANQTVLEITVTHPNY
NDPNDLMFTVIKVLGVPTGYTQVTVSQNGQPISPNLTPEYDPGKKLLTISSLQLKLGQNY
TVQWS
NT seq 5418 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggaagttcagtgggctggagctcagcctgattgccctggtcaccgtgctgact
gtggtggcctgtgtcctgatcgggctgctggccacgggagagcccggagtgaaatctcca
gacttttacccacaatgtcagaatataccaacagcagagagaattgactgcatcccagat
caattagcaacaaagagcacctgctccctccgtggctgctgctggagcccccagagtgac
accagcgtgccctggtgcttcttctctgccaagcacggctacaaagtgaagggctccaag
agagccacccaggcagggtttgaggccaccttgaagaggctgccatccccttccctcttt
gggaatgacatccagaccgtgctgctcacggcggagtaccagacacggaaccgcttccga
ttcaagatcactgaccccaagacagagaggttccaggtcccccacgagcacgtgcagccg
ttccagggctcagaagccgccgaccccagctacagggtggagctgaggcagaaccccttc
agcctcgtggtgaccaggagcagcaatggcagagtgctgtttgacacgagcatagggccc
ctgcagtatgctgaccagttcctgcagctctccatcaaactgcccagcagcaacatctac
ggcgtgggggagcacgtgcacaagcagtacaggcacaatgtcaactggaaaacctggccc
atcttcagcagggacactggcccctctgcagcaatggataacttatatggagcccacact
ttcttcctgtgtttggaagacaacactggggcctccttcggtgtgttcctgatgaacagc
aatgccatggagtttgtggtgcagcctgccccagcagtgacctacagaaccattggaggc
atcctggatttctacatcttcctgggggacactccagagcaagtagtccaggagtacctg
cagctcgtgggactgccagcactgccctcctactggagcctgggcttccagctgagccgc
tacggctacgcctcgctggacgaggtgaaggagatcgtggagaggaacagagccatcggg
ctgccctacgatgcccaagtcattgatattgattgcatggagcaaaggaaagatttcact
tatgacaaagagaagtttaaagatctccctcaatttgcaaattatttgcatgaacgtgaa
caaaaatatatcatcatattggatgctgctattggcacccaaaaaatgcttgatggaagt
gactatggagcctacatcaggggatcagagaaaaacgtctgggtgaatgagtcagatgga
acaacccccctatatggggaggtgtggccaggggaaactgtgttcccagacttcaccagc
tccacaggcacagactggtgggcagaggagtgcagattgttccatggtgaggtgccctat
gatggaatatggattgatatgaatgaagtgtgcaactttgttcaaggctcaaaaggtggt
tgtgcacagaatgatttaaattaccctccttacacccccaggattctggacaggctcatg
tattccaagacactttgcctggatgcagtgcaggcctggggcaagcaatatgatgtccac
aacctttatggatattccatgaccatcgccagtaggaaagccattgagaaggtgtttcca
ggaaagagaagcttcctcatctcaaggtctacctttgcaggatcaggaaagcacgggggc
cactggctgggggataatgcagccacctgggaccagctgagatgggcaatccctggaatg
ctggagtttaacctctttggaattccttatgttggagcagatatttgtggtttcagtgaa
aacaccacagaagaactttgcagacgatggatgcaagtgggagcattttacccattttcc
aggaaccacaacggtgaatatgtcattcatcaagatcctgctgcgtttggacccgactcc
ttgctggtgaacagctccaagcactacctgagcattcgctacaccctgctgccctacctg
tacacgctgctctaccgggcccacacccgcggggacaccgtggtgaggccactgctgcac
gagttctactctgatgaaacaacgtgggacatcgacaggcagttcctgtgggggcctggg
ctgctgatttcccctgctcttgagccgggtgtggagtccactcgtgtgtactttcctgat
gcagagtggtatgactatgacacgggtgcaccaacctctgttaggaaagtgtggcacgat
ttagaaaccccagcagataaaatgggagtgcatctgagaggaggatacattttccctact
caggagccaaacagcaccacagtgacaagccgcaggaatccaatgggactcataattgcc
ctggatctcaaccatgaagcttctggggatttgttctgggatgatggagaatctacaggt
acaattgagactaaaacctacatttactatgagtttaaagtttccaacaatactctacaa
atgactgttatacacagcaattacactgatccaaacaacctgaaatttgaggaaatcaag
atattggggttgtcccaggcaataacatcagtcactgtgtatcagaacaatgttgtgcaa
gaatatatctccaacaccacctatgatcttatgacaaaggttgctgttataagaggactt
cagcttgagctgggaaaaccttacacaatcacatggactccagatgtcaatgaaagattt
gattgctatcccggccaagacgcaacaaaagaaaaatgtgaacaacttggctgctcctgg
gaactggcagaaaatgggaaagttcctgcctgctactacaagtccagcaatccttactct
gcagagaatgtcagttattccccctctggaatcgaagccaccctcagggtggacagctcc
aaggtcagagctaacgagaattccactgcccccatcagcaccctgcgcctggaggtgaaa
tatcaccgcaacaacatgctgcagtttaagatctatgatgaccaaaacccacgctacgag
gtgccagtgcccctgaacctccccagctcccccagcccgagcgaggaccggctctacgag
gtctcgatccaggatcgaccctttgggatcgaaatccgccgcaagagcacgggcacggtc
atctggaattcaggcctgcccaccttcaccttcagcgacatgttcattcagatttccacc
cgcctgccatcccagtacatctacggatttggggaagttgagcacctcaacttccgacac
gacatgaactgggaaacctggggaatgttcaccagggaccagcctccaggttacaagatg
aattcctatggttttcagccattttatatggctcttgaagaagatggcaatgcccatgga
gttctcttgcttaacagcaatgcaatggatgtgactttccagcccacccctgccctgacc
taccgcaccaccggaggaatcctcgacttctacatggtcttgggcccgacgcccgaactc
gtggttaaggaatacactgaactggttgggcgcccagtcatgccagcctactggtccttg
gggttccagctgtgccgctacggatacgccaacgactcggagatcgcccagctcgtggag
gaaatgaaggcggcccggattccctacgatgtccaatattcagatattgactacatggaa
aggaacctggacttcaccctttccccacattttgctggattaccggctcttatcaacaaa
atcaaagcagaaggaatgagatttatcattatcctggatccagccatttctggaaatgaa
accgattatcctgccttctccagaggtgtggaacaggatgtcttcataaaatggcctgac
agcaacgagattttgtataacaaggtctggccatttcttcccaatgtcgaaatcgatgag
tcactgcctcacgaacaagtagtagagagatttggagcacactgtgctttcccagacttc
ttccgcaattccacagcggagtggtggaagaatgaaatcctggaggtctacaacaataca
aatgcctcaaaaagcctcaagtttgatggcctgtggattgacatgaatgaaccagcatct
tttataaatggcgccacgggtggctgtaagaacgacctcctaaataatcccccctacatg
cctaatttggcatataggtcagaaggattagcctacaaagctccatgcatggaagctcaa
cagtaccttgcagatggcaccccactcagacactacgacgtccacaacctttatggatgg
tcccaaaccaaaatcaccctggaggctctgcaggccgccaccaacgagcgcgggatcgtc
atcacccgctccacgtaccccagcagcgggagatgggcggggcactggctgggggacaac
acggcagcctggaaccagctgcacaaatctatcattggcatgatggagttcagtctcttt
ggaatatcttatacaggagctgatatctgtggcttcttcagtgatgcagagtatgagatg
tgtgcccgctggatgcagctgggtgcattttacccattttcaaggaatcacaacgggaaa
ggaacagtgaggcaagatcctgctttctggaattcaacttttcatgacatttccaggaat
gtgctgaacatcagatacacgctgttaccttatctctacaccttgctgttcgatgcccac
gcccacggcagcaccgtggtccgcccccttctccacgagtttgtggaagacagggtaacg
tgggatatcgacgagcagttcctctggggtcctgccctgctcatcagccctgtgttgaaa
cagaatgatcggactgtgaacgcttatttccccaatgcccgctggtatgattaccacaca
gacacagacactggctttaggggacaattccaaaatttatcggctcctttggagctcatc
aacctgcacatccgaggtggatacatcctgccttggcaaacacctgccaatacaactgcc
tacagccggaaaaacccgatgggactcacggtggccctggatgatgctctgtttgcagaa
ggacacctttattgggatgatggggttcgcattgatgcatatgaagatggtgtttacctg
ctgacatcatttactgctaatcagactgttttggagatcacagtgactcacccgaattac
aatgacccaaacgacctgatgtttactgtcatcaaagtcctgggggtgcccaccgggtac
actcaggtgacagtgtcacagaatgggcaaccaatctcaccaaacctcaccccagaatat
gaccctggcaagaagctcctgacaatctccagtctccagctgaaactgggccagaactac
accgtgcaatggagctga

DBGET integrated database retrieval system