KEGG   Ficedula albicollis (collared flycatcher): 101807464Help
Entry
101807464         CDS       T02815                                 

Gene name
EPHB2
Definition
(RefSeq) EPH receptor B2
  KO
K05111  Eph receptor B2 [EC:2.7.10.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101807464 (EPHB2)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101807464 (EPHB2)
Protein kinases [BR:fab01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   101807464 (EPHB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Ephrin_rec_like Pur_ac_phosph_N SusE DUF4998 Haspin_kinase cEGF Kdo
Motif
Other DBs
NCBI-GeneID: 101807464
NCBI-ProteinID: XP_005057802
LinkDB All DBs
Position
21
AA seq 979 aa AA seqDB search
MDSTTATAELGWTVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKYIHRRGA
HRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYFESDVDSATKTFPSWMENPWMKVDTIAA
DESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVFYRKCPRVIQN
GAVFQETLSGAESTSLVAARGTCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCRAGYESV
ENGTVCRGCPSGTFKASQGDEGCVHCPINSRTTSEGATNCVCRNGYYRADADPVDMPCTT
IPSAPQAVISSVNETSLMLEWSPPRDLGGREDLVYNIICKSCGAGRGACTRCGDNVQFAP
RQLGLTEPRVYISELLAHTQYTFEIQAVNGVTDQSPFSPHFASVNITTNQAAPSAVSIMH
QVSRTVDSITLSWSQPDQPNGVILDYELQYYEKDLSELNSTTVKSPTNTVAVQNLKAGTI
YVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSVQEKLPLIIGSSAAGLVFLIAVVVIGI
VCSRRGFERADSEYTDKLQHYTSGHSTYRGPPPALGGRSLLVTPGMKIYIDPFTYEDPNE
AVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDF
LSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGML
RGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGK
IPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPP
PMDCPNALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGMNLPLLDR
TIPDYTSFNTVDEWLDAIKMSQYKESFASAGFTTFDVVSQMTVEDILRVGVTLAGHQKKI
LNSIQVMRAQMNQIQSVEV
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggactccacaacagcgacagcagagctgggctggacagtgcatcctccatcagggtgg
gaagaggtgagtggctacgacgagaacatgaacaccatccgcacctaccaggtgtgcaac
gtcttcgagtccagccagaacaactggctgcgcaccaagtacatccacaggcgaggggcg
caccgcatccacgtggagatgaaattctccgtcagggactgcagcagcatccccaacgtg
ccaggctcctgcaaggagactttcaacctctactacttcgagtcggacgttgactcggcc
accaagacttttcccagctggatggagaatccctggatgaaggtggacaccattgctgcc
gacgagagcttctcgcaggtggacctgggcgggcgggtgatgaagatcaacaccgaggtg
cgcagtttcgggcccgtctccaggaatggcttctacctggccttccaggactacgggggc
tgcatgtccctgatcgccgtccgcgtcttctaccgcaaatgcccccgtgtcatccagaac
ggggccgtcttccaggagacgctgtcgggagcagagagcacctcgctggtggcggccagg
ggcacgtgcattgccaacgccgaggaggtggacgtgcccatcaagctgtactgcaatggg
gacggcgagtggctggtgcccatcggccgctgcatgtgccgggctggctacgagtccgtg
gagaatggcaccgtctgcagaggctgcccctcggggacattcaaggccagccagggggat
gagggctgtgtccactgccccatcaacagcaggacaacctcggaaggagccaccaactgc
gtgtgcaggaacggctattaccgggcagacgccgaccccgtggacatgccctgcaccacc
atcccctccgccccccaggccgtgatctccagcgtcaacgagacatctctgatgctggag
tggagcccccctcgggacctggggggccgcgaggacctggtgtacaacatcatctgcaag
agctgcggggcgggccgcggggcctgcacgcgctgcggcgacaacgtgcagttcgccccg
cgccagctgggcctcaccgagccccgcgtctacatcagcgagctgctggcgcacacccag
tacaccttcgagatccaggctgtcaacggcgtcaccgaccagagccccttctcgccgcac
ttcgcctccgtcaacatcaccaccaaccaggccgccccttctgctgtgtccatcatgcac
caggtgagccgtactgtggacagcatcaccctctcgtggtcccagcctgaccagcccaat
ggagtcatcctggactatgagctgcagtattatgagaaggatctgagcgagctgaactcc
accacggtgaagagccccaccaacacggtggcagtgcagaacctgaaggctggcaccatc
tacgtgttccaggtgcgggcacgcaccgtggctggctatggccgctacagcggcaagatg
tacttccagaccatgactgaagctgagtaccagaccagcgtgcaggagaagctgccgctc
atcatcggctcctcggcagcagggctggtgttcctcatcgctgtggtggtcattggcatc
gtgtgcagcagacggggcttcgagcgggcagactcggagtacacggacaagctgcagcac
tacaccagcggccacagtacgtaccgggggccccccccggccctggggggccgctccctg
ctcgtgactccagggatgaagatttacatcgatcctttcacctatgaagatcccaatgag
gctgtcagggagtttgcaaaagaaatcgatatctcttgtgtcaaaatcgagcaggtgatt
ggggcaggggagtttggagaggtgtgcagtgggcatctcaagcttccaggcaaaagagag
atctttgtggccatcaagaccctcaagtctggctacacagagaagcagaggagggacttc
ctgagtgaggccagcatcatggggcagttcgaccaccccaacgtcatccacctggagggg
gtggtcaccaagagctctccagtcatgatcatcactgagttcatggagaatggctccctg
gactccttcctgcggcaaaacgacgggcagttcacggtgatccagctggtggggatgctg
cggggcatcgccgcgggcatgaagtacctggcagacatgaactacgtgcaccgggacctg
gcagcccgcaacatcctggtcaacagcaacctggtctgcaaggtgtcggatttcggcctc
tcccgcttcctggaggacgacacctccgaccccacctacaccagcgctctgggggggaag
atcccgatccgatggacggcgcctgaggccattcagtaccgaaagttcacctcagccagt
gacgtgtggagctatgggattgtcatgtgggaggtgatgtcctatggagagagaccctac
tgggacatgaccaaccaggatgtgataaatgccatcgagcaggactatcggctgccaccc
cccatggactgccccaatgccctgcaccagctgatgctggactgttggcagaaggaccga
aaccacaggcccaaatttgggcagattgtcaacaccttggataaaatgatccgaaatccc
aacagcctgaaagccatggcacctctctcctctgggatgaacctccccctccttgaccgc
acaatcccagattacaccagcttcaacactgtggatgagtggctggatgccatcaagatg
agccagtacaaggagagctttgccagtgctggtttcaccacctttgatgtagtatctcag
atgactgtagaggacattctgcgagtcggggtcactttagcaggacaccagaagaaaatt
ctgaacagtatccaggtgatgagagcacagatgaaccaaatccagtctgtggaggtttga

DBGET integrated database retrieval system