KEGG   Ficedula albicollis (collared flycatcher): 101807567
Entry
101807567         CDS       T02815                                 

Gene name
IL2
Definition
(RefSeq) uncharacterized LOC101807567
  KO
K05429  interleukin 2
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04060  Cytokine-cytokine receptor interaction
fab04625  C-type lectin receptor signaling pathway
fab04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101807567 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101807567 (IL2)
   04672 Intestinal immune network for IgA production
    101807567 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fab04052]
    101807567 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:fab00536]
    101807567 (IL2)
Cytokines and growth factors [BR:fab04052]
 Cytokines
  Interleukins
   101807567 (IL2)
Glycosaminoglycan binding proteins [BR:fab00536]
 Heparan sulfate / Haparin
  Cytokines
   101807567 (IL2)
SSDB
Motif
Pfam: IL15 DUF2406
Other DBs
NCBI-GeneID: 101807567
NCBI-ProteinID: XP_005044721
LinkDB
Position
4
AA seq 144 aa
MCKVLVFGCIAAVILMTAAYGAPLQKTKLSPDQKQTRLEASINDLALLKHIDNNFLDFYT
PNDKQECNHTTLSCFLKELNVLKQDVEENDMQHVINIEKNLEDFKDPDFSNPTCKKCESH
EKKKFAEFHQEMTSFLQSMQKEIV
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtgcaaagtcctggtctttggctgtattgcagcagtaattctcatgactgcagcttat
ggagcacctcttcagaagactaaactatcacccgatcaaaaacagacacgtcttgaagct
tcaataaatgatttagcactcctgaaacacatcgacaataattttcttgacttttacaca
ccgaatgacaaacaggagtgcaaccacacaactctatcatgtttcctgaaagaactgaat
gtcttgaaacaagatgtggaagagaatgacatgcaacatgttataaacatcgaaaagaac
ctcgaggattttaaggaccctgatttctcaaacccaacatgcaagaagtgtgaatcccat
gagaagaaaaagtttgctgaatttcaccaagaaatgaccagcttcttgcaatctatgcag
aaagaaattgtataa

DBGET integrated database retrieval system