KEGG   Ficedula albicollis (collared flycatcher): 101807850Help
Entry
101807850         CDS       T02815                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00052  Galactose metabolism
fab00500  Starch and sucrose metabolism
fab01100  Metabolic pathways
fab04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101807850 (GAA)
   00500 Starch and sucrose metabolism
    101807850 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101807850 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101807850 (GAA)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101807850 (GAA)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101807850 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101807850
NCBI-ProteinID: XP_005056396
LinkDB All DBs
Position
18
AA seq 838 aa AA seqDB search
MRFTLPAPGLRLRVPISRGRERLSPETGSGGAVRIAAPVPVPVPVPVPVPVPVPVPVPIS
ISISVSVSVSVSVSVSVPVPVPPPQLRDAARQRYEVPLATPRVRGRAPAPLYGLQVSQDP
FGLVVCRQRGGTVLLNTTVAPLIFTDQFLQISTSLPSHFISGLGERLTPLFLDTAWSRVT
LWNRDMAPAPHVNLYGSHPFYLVMEDDGSAHGVFLLNSNAMDVLLQPSPALTWRTTGGIL
DFYIFLGPDPKSVVRQYLDVVGFPFMPPYWGLGFHLCRWGYSSTHITRQVVANMTAARFP
LDAQWNDLDYADARRDFTFDRNRFGDYPEMVRDFHSRGLRYIMIVDAGISSSGPPGTYRP
YDEGLRRGVFIRNASGQPLIGKVWPGPTAFPDFTNPRTHEWWHDMVKEFHDRVPFDGMWL
DMNEPSNFVEGSQDGCPNNNLEHPPYVPGVFGGRLQAGTICASSQQFLSSHYNLHSLYGL
SEAIASHSALLRVRGKRPFIISRSTFAGHGRYAGHWTGDVGSDWEQLYYSIPEVLLFNLF
GVPLVGADICGFAGSTSEELCVRWTQLGAFYPFMRNHNDHGTRPQEPYSFSPAAQAAMRS
ALHLRYSLLPFLYTLFHRAHAAGETVARPLFLEFPTDPNTWAVDRQLLWGGGLLVTPVLE
AGQTKVRGYFPAGTWYSLAGDSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPAFSTA
QSRSKAMALLVALTPDGFARGELFWDDGESWESFERGDYTEILFLASNAAVLSQLLRPSA
HLDGVLLQAVTVLGVTSPPQRVLANGAIVRDFSYRSDTQVLRVPVSLPMWEQFVISWS
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgagatttactttgccggctcctgggctccgcctccgtgtcccgatttcccgggggcgg
gagcggctcagccccgagaccggcagcggcggagcggtgcggatcgcagcgcccgtgccg
gtgcccgtgccggtgcccgtgccggtcccggtgccggtgccggtgccggtgccgatctcg
atctcgatctcggtctcggtctcggtctcggtctcggtctcggtctcggtgccggtgccg
gtgccgcccccgcagctccgggacgcggcccggcagcgctatgaggtgccgctggccacg
ccgcgggtgcgcggccgagccccggccccgctctacgggctgcaggtgagccaggatccc
ttcgggctcgtggtgtgccggcagcgcggcgggaccgtcctgctgaacaccacggtcgca
cccctcatcttcacagaccagttcctgcagatctccacctccctgccctcccatttcatc
tcggggctgggggagcgcctgacaccgctgttcctggacacagcatggagcagggtcacc
ctctggaaccgggacatggcaccggcgccccacgtcaacctctacggctcccaccctttc
tacctggtgatggaggacgatggttcagcccacggcgtctttctgctgaacagcaacgcc
atggacgtgctcctgcagcccagcccggccctgacctggcgcacgacgggcgggatcctg
gacttctacatcttcctgggccccgaccccaagagcgtggtgcggcagtacctggatgtc
gtgggcttccccttcatgcccccgtactgggggctgggcttccacctctgccgctggggc
tactcctccacccacatcacccggcaggtcgtggccaacatgacagcagctcgcttcccc
ctggacgcgcagtggaacgacctggactacgcggacgccaggcgggatttcaccttcgac
aggaaccgctttggggactaccccgagatggtgagggacttccacagccggggcctgagg
tacatcatgatcgtggacgctggcatcagcagctcggggccccctggcacctacaggccc
tacgatgaggggctgaggcggggggtgttcatccgaaacgcctcggggcagccgctgatc
gggaaggtctggccaggccccacagccttccccgacttcaccaacccgaggacccacgag
tggtggcacgacatggtgaaggagttccacgaccgagtgcccttcgatggcatgtggctc
gacatgaatgaaccgtccaacttcgtggagggctcccaggatggctgccccaacaacaac
ctggagcatcccccctacgtgccaggtgtgtttgggggacgcctgcaggccgggaccatc
tgtgcctccagccagcagttcctgtcctctcactacaacctgcacagcctgtacgggctg
agcgaggccatcgcctcccacagtgctctgctgagggtgcggggcaagcgtcccttcatc
atctcccgctccaccttcgccgggcacggccgctacgccgggcactggacgggggacgtt
ggcagcgactgggagcagctctactactccataccagaggtgctgctcttcaacctcttc
ggggtgccgctggtgggtgccgacatctgcggcttcgctggcagcaccagcgaggagctg
tgcgtgcgctggacccagctgggcgccttctaccccttcatgaggaaccacaacgaccac
ggcacgcggccacaggagccctactccttcagccccgctgcccaggctgccatgaggagc
gccctgcacctccgctactccctgctgcccttcctctacaccctgttccaccgggctcac
gctgcaggagagaccgtggcacggcccctcttcctggagttccccacagaccccaacacc
tgggccgtggacaggcagctcctgtggggcggggggctgctcgtcacccccgtgctggag
gcaggacagaccaaagtcagaggttacttcccagcagggacgtggtacagcctggcaggg
gactccaccatccacagcaaggggcagtggatcctcctgccagcgcccctggacaccatc
aacgtgcacgtccgtgcagggcacatcctgcccctgcaggagccggccttcagcactgcc
cagtcccgcagcaaggccatggccctgctggtggcactgaccccggacggcttcgccagg
ggagagctgttctgggacgatggggagagctgggagagctttgagaggggggactacacc
gagatcctgttcctggcctcaaacgccgccgtgctcagccagctgctgcggcccagcgcc
cacctggacggggtcctgctgcaggctgtcactgtgctgggtgtcaccagccctccccag
cgagtcctggccaacggtgccatcgtcagggacttctcctaccgcagtgacactcaggtg
ctgagggtccccgtgtcgctgcccatgtgggagcagtttgtgatctcctggtcctga

DBGET integrated database retrieval system