KEGG   Ficedula albicollis (collared flycatcher): 101808754Help
Entry
101808754         CDS       T02815                                 

Definition
(RefSeq) protein ADP-ribosylarginine hydrolase-like
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101808754
Enzymes [BR:fab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     101808754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 101808754
NCBI-ProteinID: XP_005055957
LinkDB All DBs
Position
18
AA seq 358 aa AA seqDB search
MEETVPSVESYEAAMVLSGVGDALGYRAGRWEYCTSGPQIHGELAQLGGLAAISLEPPEW
PVSDDTVLHLATAEGLATGLEGEPLLQELARRYVAAMGDMEGRKPGPSSILGTSQLRPGE
PEGYRIPFNPRGTGCGAAMRSLAIGLRYPHTWELPTLIKVSIESGRMTHHHPTGYLGALA
VALFGALGARGEPPERWGAELLRVLPLAWDYVEGTGMAVEDNAAAWPFFGEAWHRYLDSR
GLLEGRGPPRVPSLPSPAERDTEYLGWALEGWPGRSGHDAPMVALESLLAAGGSWEELCA
RAVLHGGDSDSTGTIAAGCWGLRWGLESIPPGLHRRLEHRGRLRDTAQRLHALAWGAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaggagacggtgccctcggtggagtcctacgaggctgccatggtgctgagcggggtg
ggggacgcgctgggctaccgggcaggtcgctgggagtactgcacctcgggcccccagatc
cacggcgagctggcccagctgggggggctggcagccatcagcctggagccccccgagtgg
cccgtgagcgatgacaccgtcctgcacctcgccaccgccgaggggctggccacaggcctg
gagggggagcccctcctgcaggagctggctcgccgctatgtggccgccatgggcgacatg
gagggacgcaagcccggacccagcagcatcctaggcacctcgcagctgcggccgggggag
cccgagggctatcgcatccccttcaacccccgcggcaccggctgcggggccgccatgcgc
agcctggccatcggcctcaggtacccgcacacctgggagctgccgaccctgatcaaggtg
agcatcgagagcgggcgcatgacccaccaccaccccactgggtacctcggagcactggca
gtggccctctttggggcactgggagctcggggcgaacccccagagcgctggggggctgag
ctgctgcgggtcctgcccctggcatgggactacgtggagggcaccgggatggccgtggag
gacaacgctgctgcctggccattcttcggggaggcgtggcaccggtacctggactcccgt
gggctcctggaaggccgtggcccaccacgggttccatccctcccctccccagctgagcgg
gacacagagtacctaggctgggcactggaggggtggccggggcgcagcggccacgacgca
cccatggtggccttggagtcgctgctggcagctggcgggagctgggaagagctgtgtgcc
agggcagtgctgcacggcggggacagcgactccacggggaccatcgctgctggctgctgg
gggctgcgctgggggctggaatccatcccgccagggctgcaccgccgcctggagcaccgc
gggcggctgcgcgacactgcccagcggctgcacgcgctggcctggggggcacggtga

DBGET integrated database retrieval system