KEGG   Ficedula albicollis (collared flycatcher): 101808986
Entry
101808986         CDS       T02815                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04060  Cytokine-cytokine receptor interaction
fab04068  FoxO signaling pathway
fab04144  Endocytosis
fab04218  Cellular senescence
fab04350  TGF-beta signaling pathway
fab04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101808986
   04350 TGF-beta signaling pathway
    101808986
   04068 FoxO signaling pathway
    101808986
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101808986
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101808986
  09143 Cell growth and death
   04218 Cellular senescence
    101808986
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101808986
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101808986
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101808986
Protein kinases [BR:fab01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101808986
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal FixQ
Other DBs
NCBI-GeneID: 101808986
NCBI-ProteinID: XP_005049674
UniProt: U3KGG3
LinkDB
Position
7
AA seq 556 aa
MGRWRRPALLSLLLLSLTCSARRSLKTNLCKWCDSTAPACEDKVCYSNCNLNSYCEDPYE
ICVAIWRQDNESIRISTLCHNPQRPIENLMVPNYNTSRCTMSQQPSQDGLVYICGCVDEQ
ECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKRRKRAKAW
GGKQGQPPALPEPGKAAEREEKLSVLMDESPASSRPAELLPIELDEMVGKGQFAEVWRAK
LSHSPSGQYETVAVKIFPCEEYSSWKNESQIFTDSSLRHDSVLQFLTAEDRGAGPRREYW
LITAYHSRGNLKDYLSRHVLSWRDLQKMAGSLVSGVAHLHSDYTACGRPKIPIAHRDIKS
TNVLVKSEQECVLCDFGIAIRLDPALTVDDFANSGQVGTARYMAPEVLESRVNLEDLESF
KQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLHGRGRPEIPS
SWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNNMDNQASKTA
SPAGEHQDSDGSRNIQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggggcgctggaggagaccggctctgctttccctactgctgctctccttgacctgcagc
gcccgccgcagcctcaagaccaacctgtgcaagtggtgcgactccacagctccagcctgc
gaggacaaggtgtgctacagcaactgcaacctcaactcctactgcgaggacccctacgag
atctgcgtggccatatggaggcaggacaacgagagcatcaggatcagcacgctgtgccac
aacccgcagcgccccatcgagaacctcatggtgcccaactacaacacctcgcgctgcacc
atgagccagcagcccagccaggacgggctcgtctacatctgcggctgcgtggatgagcag
gagtgcaacgacaagctcatctttgagaaccacaccaatggctactccatgctgcagagc
aaagaggtgatcccagtggctgccatcagcctcctgcccccgctgctggtggcggtgatg
atcacggtgatattttacctctgccgcacacagaagcgacgcaagagagccaaggcgtgg
ggcgggaagcagggccagccgccggcgctgccggagccggggaaggcggccgagcgggag
gagaagctgtcggtgctgatggacgagagccccgccagcagccggcccgccgagctgctg
cccatcgagctggacgagatggtgggcaaggggcagttcgccgaggtgtggagggccaag
ctgagccacagcccctcggggcagtacgagacggtggccgtgaagatcttcccctgcgag
gaatactcctcgtggaagaacgagagccagatcttcaccgacagcagcctccggcacgac
agcgtgctgcagttcctcacggccgaggaccggggcgcggggccccgccgcgagtactgg
ctcatcaccgcctaccacagccgcggcaacctcaaggactacctgtcccgccacgtgctg
agctggagggacctgcagaagatggcagggtccctggtgagcggggtggcacacctgcac
agcgactacaccgcctgcggccgccccaaaatccccatcgcccaccgcgacatcaagagc
accaacgtgctggtcaagagcgagcaggagtgcgtgctctgcgacttcggcatcgccatc
cgcctcgaccccgccctcaccgtggatgactttgccaacagcgggcaggtgggcaccgcc
aggtacatggccccagaggtcctggagtccagagtgaacctggaagacctggagtctttc
aagcagatggatgtctactccatggcccttgttttgtgggaaatggcctccagatgtgaa
gtggtaggagaggtaaagaattatgagctgccttttgggtccaaagtccaggagcagcct
tgtgtggacaccatgagggacatcgtgctgcacggcagaggccggcccgagatcccaagc
agctggctggtgcaccagggaatgcgcttcctgtgcgacaccatcaccgagtgctgggac
cacgaccccgaggcgcggctcaccgcccactgcgtggctgagcgcttcaacctgatggca
cagatggattgtgatgacatcctcaacaacaacatggacaaccaggccagcaaaacagct
tctccagctggggagcaccaggacagcgacgggagcagaaacattcagtga

DBGET integrated database retrieval system