KEGG   Ficedula albicollis (collared flycatcher): 101809249Help
Entry
101809249         CDS       T02815                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04110  Cell cycle
fab04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101809249 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101809249 (HDAC2)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101809249 (HDAC2)
Chromosome and associated proteins [BR:fab03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101809249 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     101809249 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101809249 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    101809249 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101809249
NCBI-ProteinID: XP_005043547
UniProt: U3K8U9
LinkDB All DBs
Position
3
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKTKDSSGEKTDAKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggcggcggcaagaagaaagtctgctactattacgacggtgatatt
ggaaactattactatggacaaggacatccaatgaagcctcataggatccgaatgactcac
aacttgctgctaaactatggcttgtacaggaaaatggaaatttatcgaccccacaaagca
actgctgaggaaatgaccaagtaccatagtgatgaatacatcaaatttctccgatcaata
agacctgacaatatgtctgagtacagcaagcaaatgcagagatttaatgttggagaagat
tgtcctgtatttgatggcttgtttgagttttgtcagctgtcaactggaggctctgttgct
ggggcagtaaaattgaacagacaacaaacagacatggctgtcaattgggctgggggactt
caccatgccaagaaatcggaggcatctggtttctgttatgtcaatgatattgtgcttgcc
atccttgagttactgaagtaccaccaaagagtgttgtatattgatattgatatccatcac
ggtgatggtgttgaagaagcattttataccacagatcgtgtcatgacagtatcattccat
aagtatggtgaatattttccaggcacgggagaccttagggacattggtgctggaaaaggc
aaatactatgctgtcaactttccaatgagggatggtatagatgatgaatcatatggacag
atattcaaaccaattatatctaaagtaatggagatgtaccagcccagtgctgtggtattg
cagtgtggagcagattcactgtctggggacaggctgggatgctttaatcttactgttaaa
ggtcatgctaaatgtgtggaagttgtaaagacatttaacttgccgttgctgatgttagga
ggaggaggctacacaattcgtaatgttgctcggtgctggacatatgaaactgctgttgcc
ttagattgtgaaattcctaatgagttgccatacaatgactactttgagtattttggacca
gacttcaagcttcatattagtccttcaaatatgactaatcagaatacaccagaatatatg
gagaagatcaagcagcgcttatttgagaacttgcgcatgttacctcacgcacctggtgtg
cagatgcaggccattcctgaagatgctgttcatgaagacagtggagacgaggatggagaa
gatccagacaagcgcatttctattcgagcatctgataagcgcatagcctgtgatgaagaa
ttttcagattctgaagatgaaggggaaggtggacgacgaaatgttgcagatcataagaag
ggagcgaagaaagccagaatagaagaagacaaaaaagagactgaagacaaaaaagcagat
gttaaggaggaggataaaaccaaggacagcagtggtgaaaagacagatgccaaaggagca
aaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system