KEGG   Ficedula albicollis (collared flycatcher): 101809631
Entry
101809631         CDS       T02815                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04068  FoxO signaling pathway
fab04217  Necroptosis
fab04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101809631 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101809631 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101809631 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fab03000]
    101809631 (STAT3)
Transcription factors [BR:fab03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101809631 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Baculo_PEP_C Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 101809631
NCBI-ProteinID: XP_005059709
UniProt: U3JD42
LinkDB
Position
27
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNSQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGSGSEGAESGAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacacggtacctggagcagctccaccag
ctctacagtgacagcttccccatggagctccggcagttcctggccccgtggattgaaagc
caggactgggcatatgctgccagcaaggagtcgcacgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgctttctgcaggagtccaatgtcctgtaccag
cacaacctgcgccgcatcaagcagttcctgcagagcagatacctagagaagccgatggaa
atagcccgcatcgtggctcgctgcctctgggaagagtcccggctcctgcagacagctgcc
accgcagcccagcaagggggacaggcaacacatccaacagcagctgtggtgacagagaag
cagcagatgctggagcagcacctgcaggatgtcaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggacctgaacgggaacagccagtcagtgaccaggcagaagatg
cagcagctggagcaaatgctgacagcactggaccagatgcgcaggggcatagtgagcgag
ctggctgggctgctgtcagccatggaatatgtgcagaagatgctggcagatgaggaactg
gcagattggaagagacggcagcagattgcctgcattggtggcccacccaacatctgcctg
gaccggctggagaactggataacctctctcgccgaatcgcagctacagacccggcagcag
atcaagaagttggaagaactgcagcagaaagtgtcctataagggtgacccaatcgtccag
caccggcccatgctggaggagcggattgtggagctgttcaggaacctgatgaaaagtgct
tttgttgtggagaggcagccttgcatgcccatgcacccagaccggcccctggtcatcaag
acaggtgtgcaattcaccaccaaagtcaggttgttggtcaagtttccagagctgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggcgacgttgcagcgcttcgaggg
tcccgaaagtttaacatcctggggaccaacaccaaggtcatgaacatggaggagtcgaac
aatggcagcctgtcagcagagttcaagcacctgaccctgcgggagcagcggtgtgggaat
ggaggccgagccaactgtgatgcctcgctgatagtcactgaggagctgcacctcatcact
tttgagacagaggtgtatcaccaggggctgaagatcgacctggagacccactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaatttcttcactaagccacccattgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccactaagcgtgggctc
agcatcgagcagctgaccacgctggcagaaaaactgctgggaccaggtgtgaattactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctct
ttctgggtctggctggacaacatcattgacttggtgaagaagtacatcctggcactgtgg
aacgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcccccagggacctttctgctgcgcttcagtgagagcagcaaggaaggtggcatcacc
ttcacgtgggtggagaaggacatcagtgggaagacacaaatccagtcggtggagccttac
accaagcagcagctgaacaacatgtcgtttgcggagatcatcatgggctacaaaatcatg
gatgccaccaacatcctggtgtccccgctggtgtacctgtacccagacatccccaaggag
gaggcttttggaaagtactgccgctctgagagccaggaacactcggaagcgacggactca
ggtagtgcagctccgtacctgaagaccaagttcatctgtgtcacccccacctccttcagc
aacaccattgacctgcccatgtccccgcgcaccctggactcgctgatgcagttcggcagc
ggcagcgagggcgcggagagcggcgcgggcgggcagttcgagtcgctgaccttcgacatg
gagctgacccctgagtgcgcgtcctcgcccatgtga

DBGET integrated database retrieval system